Recombinant human IL-15 protein (Active) (ab259403)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: < 0.005 Eu/µg
- Active: Yes
- Suitable for: Sandwich ELISA, HPLC, MS, SDS-PAGE, Cell Culture, Functional Studies
Description
-
Product name
Recombinant human IL-15 protein (Active)
See all IL-15 proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent proliferation of KHYG-1 cells.
ED50 is ≤1.28 ng/mL, corresponding to a specific activity of 7.8 x 105 units/mg.
-
Purity
>= 95 % SDS-PAGE.
>= 95 % HPLC. -
Endotoxin level
< 0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Predicted molecular weight
13 kDa -
Molecular weight information
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS -
Amino acids
49 to 162 -
Additional sequence information
N-terminal glycine. Mature chain lacking the signal and propeptides.
-
Specifications
Our Abpromise guarantee covers the use of ab259403 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Sandwich ELISA
HPLC
Mass Spectrometry
SDS-PAGE
Cell Culture
Functional Studies
-
Form
Lyophilized -
Additional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
Information available upon request.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with Phosphate Buffered saline.Reconstituted protein stable at -80C for 12 months or 4C for 1 week. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- IL 15
- IL-15
- IL15
see all -
Function
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. -
Tissue specificity
Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus. -
Sequence similarities
Belongs to the IL-15/IL-21 family. -
Cellular localization
Secreted and Cytoplasm. Nucleus. IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components. - Information by UniProt
Images
-
Functional Studies - Recombinant human IL-15 protein (Active) (ab259403)
Functional analysis of ab259403.
Fully biologically active determined by the dose dependent proliferation of KHYG-1 cells.
ED50 is ≤1.28 ng/mL, corresponding to a specific activity of 7.8 x 105 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot: GR3379485-1
-
Mass Spectrometry - Recombinant human IL-15 protein (Active) (ab259403)Mass determination by ESI-TOF.
Predicted MW is 12830.92 Da (+/- 10 Da by ESI-TOF). Observed MW is 12832.38 Da.
-
SDS-PAGE - Recombinant human IL-15 protein (Active) (ab259403)SDS-PAGE analysis of ab259403.
-
HPLC - Recombinant human IL-15 protein (Active) (ab259403)HPLC analysis of ab259403.
-
Sandwich ELISA - Recombinant human IL-15 protein (Active) (ab259403)Background subtracted standard curve using Human IL-15 Antibody Pair - BSA and Azide free (ab241883) and Recombinant human IL-15 protein (Active) (ab259403) in sandwich ELISA.
The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab259403 has been referenced in 1 publication.
- Marinic M et al. Evolutionary transcriptomics implicates HAND2 in the origins of implantation and regulation of gestation length. Elife 10:N/A (2021). PubMed: 33522483