Recombinant human IL-17A protein (Active) (ab282392)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% Immunogen affinity purified
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, MS, HPLC, Functional Studies
Description
-
Product name
Recombinant human IL-17A protein (Active)
See all IL-17A proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH/3T3 cells. ED50 is ≤ 7.5 ng/mL, corresponding to a specific activity of 1.33 x 105 units/mg.
-
Purity
>= 95 % Immunogen affinity purified.
=95% Purity determined by HPLC and SDS-PAGE -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR REPPHCPNSFRLEKILVSVGCTCVTPIVHHVA -
Predicted molecular weight
15 kDa -
Amino acids
24 to 155 -
Additional sequence information
N-terminal glycine
-
Specifications
Our Abpromise guarantee covers the use of ab282392 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
HPLC
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with Phosphate Buffered Saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- CTLA 8
- CTLA-8
- CTLA8
see all -
Function
Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts. -
Tissue specificity
Restricted to activated memory T-cells. -
Sequence similarities
Belongs to the IL-17 family. -
Post-translational
modificationsFound both in glycosylated and nonglycosylated forms. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional Studies - Recombinant Human IL-17A protein (ab282392)
Functional analysis of ab282392.
Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH/3T3 cells. ED50 is ≤ 7.5 ng/mL, corresponding to a specific activity of 1.33 x 105 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot GR3400366-2
-
HPLC - Recombinant Human IL-17A protein (ab282392)HPLC analysis of ab282392.
-
Mass Spectrometry - Recombinant Human IL-17A protein (ab282392)Mass determination by ESI-TOF.
Predicted MW is 15181.15 Da (+/- 10 Da by ESI-TOF). Observed MW is 15182.44 Da.
-
SDS-PAGE - Recombinant Human IL-17A protein (ab282392)SDS-PAGE analysis of ab282392.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab282392 has not yet been referenced specifically in any publications.
