Recombinant human IL-2 Receptor alpha protein (Active) (ab221397)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human IL-2 Receptor alpha protein (Active)
See all IL-2 Receptor alpha proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL-2, Tag Free at 5 μg/mL (100 μL/well) can bind ab221397 with a linear range of 0.01-1.11 μg/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNS SHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL PGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMT HGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSC -
Predicted molecular weight
24 kDa including tags -
Amino acids
22 to 213 -
Tags
His tag C-Terminus -
Additional sequence information
(NP_000408).
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab221397 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Interleukin 2 receptor alpha chain
- CD25
- CD25 antigen
see all -
Function
Receptor for interleukin-2. -
Involvement in disease
Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. -
Sequence similarities
Contains 2 Sushi (CCP/SCR) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE of reduced ab221397 stained overnight with Coomassie Blue. The protein migrates as 34-46 kDa under reducing conditions due to glycosylation.
-
Immobilized Biotinylated Human IL-2, Fc,Avitag at 1 µg/mL (100 µL/well) on streptavidin precoated (0.2 µg/well) plate, can bind ab221397 with a linear range of 1-39 ng/mL.
-
Ab221397 captured on CM5 chip via anti-His antibody, can bind Human IL-2, Tag Free with an affinity constant of 29.9 nM as determined in a SPR assay (Biacore T200).
-
Loaded ab221397 on HIS1K Biosensor, can bind Human IL-2, Tag Free with an affinity constant of 18 nM as determined in BLI assay (ForteBio Octet Red96e).
-
Ab221397 inhibits the IL-2 dependent proliferatino of Mo7e cells. The EC50 for this effect is 0.35-0.77 µg/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab221397 has not yet been referenced specifically in any publications.