Recombinant human IL-21R protein (ab184891)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 92% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human IL-21R protein
See all IL-21R proteins and peptides -
Biological activity
Measured by its ability to bind Human IL21 in a functional ELISA.
-
Purity
> 92 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHR SAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIK PAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAV SPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSD PVIFQTQSEELKEGWNP -
Predicted molecular weight
26 kDa including tags -
Amino acids
20 to 236 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab184891 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.
pH: 7.40
Constituents: 95% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- CD360
- IL 21R
- IL-21 receptor
see all -
Function
This is a receptor for interleukin-21. -
Tissue specificity
Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Contains 2 fibronectin type-III domains. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Post-translational
modificationsC-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human IL-21R protein (ab184891)Human IL-21 R, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 92%.
-
Functional Studies - Recombinant human IL-21R protein (ab184891)Immobilized Biotinylated Human IL-21, Fc Tag at 2 µg/mL (100 µL/well) can bind Human IL-21 R, His Tag with a linear range of 2-8 ng/mL. -
SDS-PAGE - Recombinant human IL-21R protein (ab184891)SDS-PAGE analysis ab184891 stained overnight with Coomassie Blue.
DTT-reduced Protein migrates as 42-50 kDa due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab184891 has not yet been referenced specifically in any publications.
