For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-il-6-protein-active-ab259381.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines Interleukins
Share by email
Premium bioactive grade

Recombinant human IL-6 protein (Active) (ab259381)

  • Datasheet
  • SDS
Reviews (1) Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human IL-6 protein (Active) (ab259381)
  • SDS-PAGE - Recombinant human IL-6 protein (Active) (ab259381)
  • Sandwich ELISA - Recombinant human IL-6 protein (Active) (ab259381)
  • HPLC - Recombinant human IL-6 protein (Active) (ab259381)
  • Mass Spectrometry - Recombinant human IL-6 protein (Active) (ab259381)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 95% SDS-PAGE
  • Endotoxin level: < 0.005 Eu/µg
  • Active: Yes
  • Suitable for: Cell Culture, Sandwich ELISA, Functional Studies, MS, SDS-PAGE, HPLC

You may also be interested in

ELISA
Product image
Human IL-6 ELISA Kit (ab178013)
Knockout
Product image
Human IL-6 knockout A549 cell line (ab273751)
Primary
Product image
Anti-IL-6 antibody (ab6672)

View more associated products

Description

  • Product name

    Recombinant human IL-6 protein (Active)
    See all IL-6 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of TF-1 cells is 0.8067 ng/mL corresponding to a specific activity of 1.24 x 106 IU/mg.

  • Purity

    >= 95 % SDS-PAGE.
    Purity by HPLC >=95%.
  • Endotoxin level

    < 0.005 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P05231
  • Protein length

    Full length protein
  • Animal free

    Yes
  • Carrier free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Predicted molecular weight

      21 kDa
    • Molecular weight information

      M+1 Da, pass (+203 Da: Hex, +203: HexNAc, +291:NeuAc). APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
    • Amino acids

      28 to 212
    • Additional sequence information

      N-terminal glycine. Mature chain.

Specifications

Our Abpromise guarantee covers the use of ab259381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Cell Culture

    Sandwich ELISA

    Functional Studies

    Mass Spectrometry

    SDS-PAGE

    HPLC

  • Form

    Lyophilized
  • Additional notes

    This protein is filter sterilized prior to aliquoting and lyophilization. All aliquoting and lyophilization steps are performed in a sterile environment

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at Room Temperature.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.

General Info

  • Alternative names

    • Interleukin BSF 2
    • B cell differentiation factor
    • B cell stimulatory factor 2
    • B-cell stimulatory factor 2
    • BSF 2
    • BSF-2
    • BSF2
    • CDF
    • CTL differentiation factor
    • Cytotoxic T cell differentiation factor
    • Hepatocyte stimulating factor
    • Hepatocyte stimulatory factor
    • HGF
    • HSF
    • Hybridoma growth factor
    • Hybridoma growth factor Interferon beta-2
    • Hybridoma plasmacytoma growth factor
    • IFN-beta-2
    • IFNB2
    • IL 6
    • IL-6
    • IL6
    • IL6_HUMAN
    • Interferon beta 2
    • Interferon beta-2
    • Interleukin 6
    • Interleukin 6 (interferon beta 2)
    • Interleukin BSF 2
    • Interleukin-6
    see all
  • Function

    Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
  • Involvement in disease

    Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
    Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P05231 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human IL-6 protein (Active) (ab259381)
    Functional Studies - Recombinant human IL-6 protein (Active) (ab259381)

    Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of TF-1 cells is 0.8067 ng/mL corresponding to a specific activity of 1.24 x 106 IU/mg.

  • SDS-PAGE - Recombinant human IL-6 protein (Active) (ab259381)
    SDS-PAGE - Recombinant human IL-6 protein (Active) (ab259381)

    SDS-PAGE analysis of ab259381.

  • Sandwich ELISA - Recombinant human IL-6 protein (Active) (ab259381)
    Sandwich ELISA - Recombinant human IL-6 protein (Active) (ab259381)

    Sandwich ELISA - Recombinant human IL-6 protein standard curve.

    Background subtracted standard curve using Human IL-6 Antibody Pair - BSA and Azide free (ab243973) and Recombinant human IL-6 protein (Active) (ab259381) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

  • HPLC - Recombinant human IL-6 protein (Active) (ab259381)
    HPLC - Recombinant human IL-6 protein (Active) (ab259381)

    Purity 99%.

    The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

  • Mass Spectrometry - Recombinant human IL-6 protein (Active) (ab259381)
    Mass Spectrometry - Recombinant human IL-6 protein (Active) (ab259381)

    M+1 Da, pass (+203 Da: Hex, +203: HexNAc, +291:NeuAc).

    The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab259381? Please let us know so that we can cite the reference in this datasheet.

ab259381 has been referenced in 1 publication.

  • Li Y  et al. Potential effect of Maxing Shigan decoction against coronavirus disease 2019 (COVID-19) revealed by network pharmacology and experimental verification. J Ethnopharmacol 271:113854 (2021). PubMed: 33513419

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review

Filter by Application

Filter by Ratings

IL6 addition can improve the blastocysts efficiency.

Excellent
Abreviews
Abreviews
abreview image
Application
Functional Studies
100ng/mL volume IL6 can efficiently improve the blastocysts rate.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Dec 23 2021

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.