Recombinant human IL-8 protein (Active) (ab259397)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: < 0.005 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, MS, HPLC, Functional Studies, Cell Culture
Description
-
Product name
Recombinant human IL-8 protein (Active)
See all IL-8 proteins and peptides -
Biological activity
Fully biologically active as determined by the dose dependant migration of human PBMCs.
ED50 is ≤ 12 ng/mL, corresponding to a specific activity of 8.33 x 104 units/mg.
-
Purity
>= 95 % SDS-PAGE.
Purity by HPLC >=95%. -
Endotoxin level
< 0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Predicted molecular weight
8 kDa -
Molecular weight information
M +/- 0 Da (Calc mass 8356 Da) AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS -
Amino acids
29 to 99 -
Additional sequence information
N-terminal Glycine. Mature IL-8 (7-77) chain.
-
Specifications
Our Abpromise guarantee covers the use of ab259397 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
HPLC
Functional Studies
Cell Culture
-
Form
Lyophilized -
Additional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 6.00
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose
Buffer lyophilized from.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- (Ala-IL-8)77
- (Ser-IL-8)72
- 9E3
see all -
Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsSeveral N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional Studies - Recombinant Human IL-8 protein (Active) (ab259397)
Fully biologically active as determined by the dose dependant migration of human PBMCs.
ED50 is ≤ 12 ng/mL, corresponding to a specific activity of 8.33 x 104 units/mg.
-
SDS-PAGE - Recombinant Human IL-8 protein (Active) (ab259397)SDS-PAGE analysis of ab259397.
-
HPLC - Recombinant Human IL-8 protein (Active) (ab259397)Purity = 100%.
The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water: TFA (99.9:0.1 v/v) and 20 % acetonitrile:waterTFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.
-
Mass Spectrometry - Recombinant Human IL-8 protein (ab259397)M +/- 0 Da (Calc mass 8356 Da).
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab259397 has not yet been referenced specifically in any publications.