Recombinant human M-CSF protein (Active) (ab259396)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: < 0.005 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, MS, Cell Culture, HPLC
Description
-
Product name
Recombinant human M-CSF protein (Active)
See all M-CSF proteins and peptides -
Biological activity
Fully active compared to a standard. The ED50 as determined by the dose-dependant proliferation of MNFS-60 cells is 5.164ng/mL corresponding to a Specific Activity of 1.94 x 105 IU/mg.
-
Purity
>= 95 % SDS-PAGE.
Purity by HPLC >=95%. -
Endotoxin level
< 0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQYIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCN -
Predicted molecular weight
19 kDa -
Actual molecular weight
19 kDa -
Molecular weight information
M +1 Da by ESI TOF (Calc. mass 18513 Da) EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQYIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN -
Amino acids
33 to 190 -
Additional sequence information
N-terminal Glycine
-
Specifications
Our Abpromise guarantee covers the use of ab259396 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
Mass Spectrometry
Cell Culture
HPLC
-
Form
Lyophilized -
Additional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 6.00
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose
Buffer reconstituted from.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- Colony stimulating factor 1
- Colony stimulating factor 1 (macrophage)
- Colony stimulating factor macrophage specific
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. -
Post-translational
modificationsGlycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
Images
-
Functional Studies - Recombinant human M-CSF protein (ab259396)
Fully active compared to a standard. The ED50 as determined by the dose-dependant proliferation of MNFS-60 cells is 5.164ng/mL corresponding to a Specific Activity of 1.94 x 105 IU/mg.
-
SDS-PAGE - Recombinant human M-CSF protein (ab259396)SDS-PAGE analysis of ab259396.
-
HPLC - Recombinant human M-CSF protein (ab259396)Purity 100%
The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.
-
Mass Spectrometry - Recombinant human M-CSF protein (ab259396)M + 1 Da (Calc mass 18513 Da)
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab259396 has not yet been referenced specifically in any publications.