Recombinant Human PABPN1 protein (denatured) (ab177635)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human PABPN1 protein (denatured) -
Purity
> 95 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSLEAIKARVREMEEEAEKLKELQNEVEK QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG RARATSWYSPY -
Predicted molecular weight
24 kDa including tags -
Amino acids
119 to 306 -
Tags
His tag N-Terminus -
Additional sequence information
NP_004634.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab177635 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Nuclear poly(A)-binding protein 1
- OPMD
- PAB2
see all -
Function
Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Is also present at various stages of mRNA metabolism including nucleocytoplasmic trafficking and nonsense-mediated decay (NMD) of mRNA. Cooperates with SKIP to synergistically activate E-box-mediated transcription through MYOD1 and may regulate the expression of muscle-specific genes. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation. -
Tissue specificity
Ubiquitous. -
Involvement in disease
Defects in PABPN1 are the cause of oculopharyngeal muscular dystrophy (OPMD) [MIM:164300]. OPMD is a form of late-onset slowly progressive myopathy characterized by eyelid ptosis, dysphagia and, sometimes by other cranial and limb-muscle involvement. -
Sequence similarities
Contains 1 RRM (RNA recognition motif) domain. -
Domain
The RRM domain is essential for specific adenine bases recognition in the poly(A) tail but not sufficient for poly(A) binding. -
Post-translational
modificationsArginine dimethylation is asymmetric and involves PRMT1 and PRMT3. It does not influence the RNA binding properties. -
Cellular localization
Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles between the nucleus and the cytoplasm but predominantly found in the nucleus. Its nuclear import may involve the nucleocytoplasmic transport receptor transportin and a RAN-GTP-sensitive import mechanism. Is exported to the cytoplasm by a carrier-mediated pathway that is independent of mRNA traffic. Nucleus; nuclear speckle. Colocalizes with SKIP and poly(A) RNA in nuclear speckles. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human PABPN1 protein (denatured) (ab177635)
15% SDS-PAGE analysis of ab177635 (3µg).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab177635 has not yet been referenced specifically in any publications.