For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-pd-l1-protein-active-ab167713.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Cell Type Markers CD Non-lineage
Share by email
Bioactive grade

Recombinant human PD-L1 protein (Active) (ab167713)

  • Datasheet
  • SDS
Submit a review Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human PD-L1 protein (ab167713)
  • Functional Studies - Recombinant human PD-L1 protein (Active) (ab167713)
  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
  • Functional Studies - Recombinant human PD-L1 protein (Active) (ab167713)
  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
  • SDS-PAGE - Recombinant human PD-L1 protein (Active) (ab167713)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 98% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: HPLC, SDS-PAGE, Functional Studies

Achieve higher consistency and quality standards with a premium grade bioactive protein

Product image
Recombinant human PD-L1 protein (Active) (ab280943)
  • High batch-to-batch consistency
  • Optimal bioactivity
  • Guaranteed identical to human native proteins
  • >95% purity
  • Ultra-low endotoxin levels: <0.005 Eu/µg
  • Carrier and tag free

Description

  • Product name

    Recombinant human PD-L1 protein (Active)
    See all PD-L1 proteins and peptides
  • Biological activity

    Immobilized ab167713 on Anti-His Tag (C-term) Antibody, precoated (0.1 μg/well) plate, binds Human PD-1, Mouse IgG2a Fc Tag (HPLC-verified), at 5 μg/mL (100 μL/well) with a linear range of 10-78 ng/mL.

  • Purity

    > 98 % SDS-PAGE.
    >90% as determined by SEC-HPLC. Purified by Immobilized metal affinity chromatography.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    Q9NZQ7
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFV HGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEE NHTAELVIPELPLAHPPNER
    • Predicted molecular weight

      26 kDa including tags
    • Molecular weight information

      The protein migrates as 30-35 kDa under reducing conditions due to glycosylation.
    • Amino acids

      19 to 238
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_054862.1)

Associated products

  • Corresponding Antibody

    • Anti-PD-L1 antibody [28-8] (ab205921)
  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Recombinant human PD1 protein (Fc Chimera Active) (ab221398)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab167713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilized
  • Additional notes

    For a recombinant rabbit monoclonal antiody to PD-L1 in IHC usage and KO validated - see ab205921 (clone 28-8)

    For a recombinant rabbit monoclonal antiody to PD-L1 in WB and ICC/IF usage - see ab174838 (clone EPR1161(2))

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

General Info

  • Alternative names

    • B7 H
    • B7 H1
    • B7 homolog 1
    • B7-H1
    • B7H
    • B7H1
    • CD 274
    • CD-274
    • CD274
    • CD274 antigen
    • CD274 molecule
    • MGC142294
    • MGC142296
    • OTTHUMP00000021029
    • PD L1
    • PD-L1
    • PD1L1_HUMAN
    • PDCD1 ligand 1
    • PDCD1L1
    • PDCD1LG1
    • PDL 1
    • PDL1
    • Programmed cell death 1 ligand 1
    • Programmed death ligand 1
    • RGD1566211
    see all
  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production.
  • Tissue specificity

    Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane and Endomembrane system.
  • Target information above from: UniProt accession Q9NZQ7 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (ab167713)

    Immobilized ab167713 at 1 μg/mL (100 μL/well) binds Anti-Human PD-L1 MAb (Human IgG1).

    Linear range of 0.1-3 ng/mL (QC tested).

  • Functional Studies - Recombinant human PD-L1 protein (Active) (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (Active) (ab167713)
    The purity of Human PD-L1 (His Tag) (HPLC verified) was greater than 90% as determined by SEC-HPLC.
  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (ab167713)

    Immobilized ab167713 on Anti-His Tag (C-term) Antibody, precoated (0.1 μg/well) plate, binds Human PD-1, Mouse IgG2a Fc Tag (HPLC-verified), at 5 μg/mL (100 μL/well).

    Linear range of 10-78 ng/mL (Routinely tested).

  • Functional Studies - Recombinant human PD-L1 protein (Active) (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (Active) (ab167713)

    Loaded Recombinant human PD1 protein (Fc Chimera Active) ab221398 on ProteinA Biosensor, can bind Human PD-L1, His Tag ab167713 with an affinity constant of 5.3 μM as determined in BLI assay.

  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (ab167713)

    Biotinylated Human PD-1, Fc Tag (ab246137) binds Recombinant human PD-L1 protein ab167713 at 1 μg/mL (5μL/well).

    Linear range of 0.02-0.625 μg/mL as determined in a alphaLISA homogeneous assay (Routinely tested).

  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (ab167713)

    Human PD-1, Fc Tag (ab221398), captured on CM5 chip via anti-human IgG Fc antibody, binds ab167713 with an affinity constant of 3.6 μM, as determined in an SPR assay (Biacore T200).

  • Functional Studies - Recombinant human PD-L1 protein (ab167713)
    Functional Studies - Recombinant human PD-L1 protein (ab167713)

    Anti-Human PD-L1 Mab (Human IgG1), captured on CM5 chip via anti-human IgG Fc antibodies surface, binds ab167713 with an affinity constant of 0.286 nM, as determined in a SPR assay (Biacore T200) (Routinely tested).

  • SDS-PAGE - Recombinant human PD-L1 protein (Active) (ab167713)
    SDS-PAGE - Recombinant human PD-L1 protein (Active) (ab167713)

    Reduced ab167713 on SDS-PAGE, stained overnight with Coomassie Blue.

    The purity of the protein is greater than 98%.

    The protein migrates as 30-35 kDa under reducing conditions, due to glycosylation.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (2)

Publishing research using ab167713? Please let us know so that we can cite the reference in this datasheet.

ab167713 has been referenced in 2 publications.

  • Riccio A  et al. The Stone Guest: How Does pH Affect Binding Properties of PD-1/PD-L1 Inhibitors? ChemMedChem 16:568-577 (2021). PubMed: 33085193
  • Guo F  et al. Cell Penetrating Peptide-Based Self-Assembly for PD-L1 Targeted Tumor Regression. Int J Mol Sci 22:N/A (2021). PubMed: 34948105

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab167713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.