Recombinant human PD-L1 protein (Active) (ab167713)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: HPLC, SDS-PAGE, Functional Studies
Achieve higher consistency and quality standards with a premium grade bioactive protein
- High batch-to-batch consistency
- Optimal bioactivity
- Guaranteed identical to human native proteins
- >95% purity
- Ultra-low endotoxin levels: <0.005 Eu/µg
- Carrier and tag free
Description
-
Product name
Recombinant human PD-L1 protein (Active)
See all PD-L1 proteins and peptides -
Biological activity
Immobilized ab167713 on Anti-His Tag (C-term) Antibody, precoated (0.1 μg/well) plate, binds Human PD-1, Mouse IgG2a Fc Tag (HPLC-verified), at 5 μg/mL (100 μL/well) with a linear range of 10-78 ng/mL.
-
Purity
> 98 % SDS-PAGE.
>90% as determined by SEC-HPLC. Purified by Immobilized metal affinity chromatography. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFV HGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEE NHTAELVIPELPLAHPPNER -
Predicted molecular weight
26 kDa including tags -
Molecular weight information
The protein migrates as 30-35 kDa under reducing conditions due to glycosylation. -
Amino acids
19 to 238 -
Tags
His tag C-Terminus -
Additional sequence information
(NP_054862.1)
-
Associated products
-
Corresponding Antibody
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab167713 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
For a recombinant rabbit monoclonal antiody to PD-L1 in IHC usage and KO validated - see ab205921 (clone 28-8)
For a recombinant rabbit monoclonal antiody to PD-L1 in WB and ICC/IF usage - see ab174838 (clone EPR1161(2))
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 5% Trehalose
0.22 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- B7 H
- B7 H1
- B7 homolog 1
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. -
Tissue specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane and Endomembrane system. - Information by UniProt
Images
-
Immobilized ab167713 at 1 μg/mL (100 μL/well) binds Anti-Human PD-L1 MAb (Human IgG1).
Linear range of 0.1-3 ng/mL (QC tested).
-
The purity of Human PD-L1 (His Tag) (HPLC verified) was greater than 90% as determined by SEC-HPLC.
-
Immobilized ab167713 on Anti-His Tag (C-term) Antibody, precoated (0.1 μg/well) plate, binds Human PD-1, Mouse IgG2a Fc Tag (HPLC-verified), at 5 μg/mL (100 μL/well).
Linear range of 10-78 ng/mL (Routinely tested).
-
Loaded Recombinant human PD1 protein (Fc Chimera Active) ab221398 on ProteinA Biosensor, can bind Human PD-L1, His Tag ab167713 with an affinity constant of 5.3 μM as determined in BLI assay.
-
Biotinylated Human PD-1, Fc Tag (ab246137) binds Recombinant human PD-L1 protein ab167713 at 1 μg/mL (5μL/well).
Linear range of 0.02-0.625 μg/mL as determined in a alphaLISA homogeneous assay (Routinely tested).
-
Human PD-1, Fc Tag (ab221398), captured on CM5 chip via anti-human IgG Fc antibody, binds ab167713 with an affinity constant of 3.6 μM, as determined in an SPR assay (Biacore T200).
-
Anti-Human PD-L1 Mab (Human IgG1), captured on CM5 chip via anti-human IgG Fc antibodies surface, binds ab167713 with an affinity constant of 0.286 nM, as determined in a SPR assay (Biacore T200) (Routinely tested).
-
Reduced ab167713 on SDS-PAGE, stained overnight with Coomassie Blue.
The purity of the protein is greater than 98%.
The protein migrates as 30-35 kDa under reducing conditions, due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab167713 has not yet been referenced specifically in any publications.