Recombinant human PD-L1 protein (Active) (ab182689)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: StrepII tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies, ELISA
Achieve higher consistency and quality standards with a premium grade bioactive protein
- High batch-to-batch consistency
- Optimal bioactivity
- Guaranteed identical to human native proteins
- >95% purity
- Ultra-low endotoxin levels: <0.005 Eu/µg
- Carrier and tag free
Description
-
Product name
Recombinant human PD-L1 protein (Active)
See all PD-L1 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab182689 at 5 μg/mL (100 μL/well) can bind Recombinant human PD1 protein (Active) (Biotin) (ab246155) with a linear range of 0.002-0.25 μg/mL.
Measured by its binding ability in a BLI assay. Loaded Anti-Human PD-L1 MAb (Human IgG1) on AHC Biosensor, can bind ab182689 with an affinity constant of 0.891 nM as determined.
Measured by its binding ability in a BLI assay. Loaded Recombinant human PD1 protein (Fc Chimera Active) (ab221398) on Protein A Biosensor, can bind ab182689 with an affinity constant of 2.2 μM as determined.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFV HGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEE NHTAELVIPELPLAHPPNER -
Predicted molecular weight
28 kDa including tags -
Amino acids
19 to 238 -
Tags
StrepII tag C-Terminus -
Additional sequence information
Extracellular domain. C terminal Strep II-tag. NP_054862.1.
-
Specifications
Our Abpromise guarantee covers the use of ab182689 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
ELISA
-
Form
Lyophilized -
Additional notes
Reconstitute with sterile deionized water to a concentration of 200 µg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Please see notes section. Reconstitute for long term storage.
pH: 7.40
Constituents: 5% Trehalose, 95% PBSThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- B7 H
- B7 H1
- B7 homolog 1
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. -
Tissue specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane and Endomembrane system. - Information by UniProt
Images
-
ELISA - Recombinant human PD-L1 protein (Active) (ab182689)
Immobilized ab182689 at 5 μg/mL (100 μL/well) can bind Recombinant human PD1 protein (Active) (Biotin) (ab246155) with a linear range of 0.002-0.25 μg/mL.
-
Functional Studies - Recombinant human PD-L1 protein (Active) (ab182689)Loaded Anti-Human PD-L1 MAb (Human IgG1) on AHC Biosensor, can bind ab182689 with an affinity constant of 0.891 nM as determined in BLI assay.
-
SDS-PAGE - Recombinant human PD-L1 protein (ab182689)Human PD-L1, Strep Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The protein migrates as 35-42 kDa due to glycosylation.
-
Functional Studies - Recombinant human PD-L1 protein (Active) (ab182689)Loaded Recombinant human PD1 protein (Fc Chimera Active) (ab221398) on Protein A Biosensor, can bind ab182689 with an affinity constant of 2.2 μM as determined in BLI assay.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab182689 has not yet been referenced specifically in any publications.
