Recombinant Human SDHA protein (Tagged) (ab226268)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human SDHA protein (Tagged)
See all SDHA proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKL FPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMT EQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVA DRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGS IHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV -
Predicted molecular weight
54 kDa including tags -
Amino acids
44 to 293 -
Tags
GST tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab226268 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 50% Glycerol, Tris buffer
General Info
-
Alternative names
- CMD1GG
- DHSA_HUMAN
- Flavoprotein subunit of complex II
see all -
Function
Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). -
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1. -
Involvement in disease
Defects in SDHA are a cause of mitochondrial complex II deficiency (MT-C2D) [MIM:252011]. A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations. Clinical features include psychomotor regression in infants, poor growth with lack of speech development, severe spastic quadriplegia, dystonia, progressive leukoencephalopathy, muscle weakness, exercise intolerance, cardiomyopathy. Some patients manifest Leigh syndrome or Kearns-Sayre syndrome.
Defects in SDHA are a cause of Leigh syndrome (LS) [MIM:256000]. LS is a severe disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions.
Defects in SDHA are the cause of cardiomyopathy dilated type 1GG (CMD1GG) [MIM:613642]. CMD1GG is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. -
Sequence similarities
Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human SDHA protein (Tagged) (ab226268)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226268 with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226268 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SDHA.
-
Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226268 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SDHA.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab226268 has not yet been referenced specifically in any publications.