Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Flow Cyt, ELISA, SDS-PAGE, HPLC, Functional Studies
Description
-
Product name
Recombinant human SIRP alpha protein (Fc Chimera Active)
See all SIRP alpha proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Recombinant human CD47 protein (Active) (ab174029) at 2 µg/mL (100 µL/well) can bind ab221342 with a linear range of 4-31 ng/mL.
Measured by its binding ability in a functional ELISA. Serial dilutions of Anti-Human CD47 Neutralizing Antibody were added into ab221342: Recombinant human CD47 protein (Fc Chimera Active) (Biotin) (ab246018) binding reactions. The half maximal inhibitory concentration (IC50) is 0.2006 µg/mL.
Measured by its binding ability in FACS. The binding of ab221342 to Jurkat expressing CD47 was inhibited by increasing concentration of neutralizing anti-CD47 antibody. The concentration of SIRP alpha used is 0.3 µg/ml. IC50=0.1318 µg/ml.
Measured by its binding ability in FACS. Recombinant ab221342 can bind to Jurkat cell expressing CD47. The concentration of SIRP alpha used is 0.3 µg/ml.
-
Purity
> 95 % SDS-PAGE.
>90% pure as determined by SEC-HPLC. Protein A purified. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLT CQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNER -
Predicted molecular weight
64 kDa including tags -
Amino acids
31 to 370 -
Tags
Fc tag C-Terminus -
Additional sequence information
This protein carries a mouse IgG1 Fc tag at the C-terminus (Val 98-Lys 324; AAK53870.1). (NP_001035111).
-
Specifications
Our Abpromise guarantee covers the use of ab221342 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Flow Cytometry
ELISA
SDS-PAGE
HPLC
Functional Studies
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 500 µg/ml.
General Info
-
Alternative names
- Signal regulatory protein alpha type 1
- Bit
- Brain Ig like molecule with tyrosine based activation motifs
see all -
Function
Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. -
Tissue specificity
Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas. -
Sequence similarities
Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsN-glycosylated.
Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11. -
Cellular localization
Membrane. - Information by UniProt
Images
-
ELISA - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)
Recombinant human CD47 protein (Active) (ab174029) at 2 µg/mL (100 µL/well) can bind ab221342 with a linear range of 4-31 ng/mL.
-
SDS-PAGE - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)SDS PAGE of reduced ab221342 stained overnight with Coomassie Blue. The protein migrates as 70-105 kDa under reducing conditions due to glycosylation.
-
HPLC - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)The purity of ab221342 was greater than 90% as determined by SEC-HPLC.
-
ELISA - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)Serial dilutions of Anti-Human CD47 Neutralizing Antibody were added into ab221342: Recombinant human CD47 protein (Fc Chimera Active) (Biotin) (ab246018) binding reactions. The half maximal inhibitory concentration (IC50) is 0.2006 µg/mL.
-
Flow Cytometry - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)FACS assay shows that recombinant ab221342 can bind to Jurkat cell expressing CD47. The concentration of SIRP alpha used is 0.3 µg/ml.
-
Functional Studies - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221342)FACS analysis shows that the binding of ab221342 to Jurkat expressing CD47 was inhibited by increasing concentration of neutralizing anti-CD47 antibody. The concentration of SIRP alpha used is 0.3 µg/ml. IC50=0.1318 µg/ml.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab221342 has not yet been referenced specifically in any publications.