Recombinant Human SRD5A2 protein (ab114946)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human SRD5A2 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA -
Predicted molecular weight
30 kDa including tags -
Amino acids
28 to 65
-
Specifications
Our Abpromise guarantee covers the use of ab114946 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 3 oxo 5 alpha steroid 4 dehydrogenase 2
- 3-oxo-5-alpha-steroid 4-dehydrogenase 2
- 5 alpha SR2
see all -
Function
Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. -
Tissue specificity
Expressed in high levels in the prostate and many other androgen-sensitive tissues. -
Involvement in disease
Defects in SRD5A2 are the cause of pseudovaginal perineoscrotal hypospadias (PPSH) [MIM:264600]. A form of male pseudohermaphroditism in which 46,XY males show ambiguous genitalia at birth, including perineal hypospadias and a blind perineal pouch, and develop masculinization at puberty. The name of the disorder stems from the finding of a blind-ending perineal opening resembling a vagina and a severely hypospadiac penis with the urethra opening onto the perineum. -
Sequence similarities
Belongs to the steroid 5-alpha reductase family. -
Cellular localization
Microsome membrane. Endoplasmic reticulum membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human SRD5A2 protein (ab114946)12.5% SDS-PAGE showing ab114946 at approximately 29.81kDa.
Stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab114946 has not yet been referenced specifically in any publications.
