For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-human-traf6-protein-ab132023.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Receptors Associated Proteins
Share by email

Recombinant Human TRAF6 protein (ab132023)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human TRAF6 protein (ab132023)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: SDS-PAGE, ELISA, WB

    You may also be interested in

    Peptide
    TRAF6 peptide (ab183540)
    Knockout
    Product image
    Human TRAF6 knockout HeLa cell line (ab266009)
    Primary
    Product image
    Anti-TRAF6 antibody [EP591Y] (ab33915)

    View more associated products

    Description

    • Product name

      Recombinant Human TRAF6 protein
      See all TRAF6 proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      Q9Y4K3
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MSLLNCENSCGFSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFM EEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRD AGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLED HQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFED KEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCN GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTA QRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIM DAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVS TRFDMGSLRREGFQPRSTDAGV
      • Predicted molecular weight

        86 kDa
      • Amino acids

        1 to 522
      • Tags

        GST tag N-Terminus

    Associated products

    • Related Products

      • Anti-TRAF6 antibody [EP591Y] (ab33915)
      • Anti-TRAF6 antibody [EP592Y] (ab40675)
      • Anti-TRAF6 antibody (ab62488)

    Specifications

    Our Abpromise guarantee covers the use of ab132023 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      ELISA

      Western blot

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • E3 ubiquitin-protein ligase TRAF6
      • Interleukin 1 signal transducer
      • Interleukin-1 signal transducer
      • MGC 3310
      • MGC:3310
      • MGC3310
      • OTTHUMP00000232772
      • OTTHUMP00000232773
      • RING finger protein 85
      • RNF 85
      • RNF85
      • TNF receptor associated factor 6
      • TNF receptor-associated factor 6
      • TNF receptor-associated factor 6, E3 ubiquitin protein ligase
      • TRAF 6
      • Traf6
      • TRAF6_HUMAN
      see all
    • Function

      E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c-Myb-mediated transactivation, in B lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor.
    • Tissue specificity

      Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
    • Pathway

      Protein modification; protein ubiquitination.
    • Sequence similarities

      Belongs to the TNF receptor-associated factor family. A subfamily.
      Contains 1 MATH domain.
      Contains 1 RING-type zinc finger.
      Contains 2 TRAF-type zinc fingers.
    • Domain

      The coiled coil domain mediates homo- and hetero-oligomerization.
      The MATH/TRAF domain binds to receptor cytoplasmic domains.
    • Post-translational
      modifications

      Sumoylated on Lys-124, Lys-142 and Lys-453 by SUMO1.
      Polyubiquitinated on Lys-124; after cell stimulation with IL-1-beta or TGF-beta. This ligand-induced cell stimulation leads to dimerization/oligomerization of TRAF6 molecules, followed by auto-ubiquitination which involves UBE2N and UBE2V1 and leads to TRAF6 activation. This 'Lys-63' site-specific poly-ubiquitination appears to be associated with the activation of signaling molecules. Endogenous autoubiquitination occurs only for the cytoplasmic form.
    • Cellular localization

      Cytoplasm. Cytoplasm > cell cortex. Nucleus. Found in the nuclei of some agressive B-cell lymphoma cell lines as well as in the nuclei of both resting and activated T-and B-lymphocytes. Found in punctate nuclear body protein complexes. Ubiquitination may occur in the cytoplasm and sumoylation in the nucleus.
    • Target information above from: UniProt accession Q9Y4K3 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human TRAF6 protein (ab132023)
      SDS-PAGE - Recombinant Human TRAF6 protein (ab132023)
      12.5% SDS-PAGE stained with Coomassie Blue showing ab132023 at approximately 86 kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab132023? Please let us know so that we can cite the reference in this datasheet.

    ab132023 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Does your recombinant TRAF6 have activity (E3 ligase)? What expression system did you use to generate this proteins?

    Read More

    Abcam community

    Verified customer

    Asked on Aug 25 2014

    Answer

    We have not tested the recombinant TRAF6 ab132023 in an activity assay. It may have activity but the only we have data are from the immunoassays listed on the datasheet, ELISA and western blotting. The expression system was wheat germ. The web page at the following link contains a basic introduction to this expression system.

    https://www.abcam.com/?pageconfig=resource&rid=14021

    Read More

    Tom Ruyle

    Abcam Scientific Support

    Answered on Aug 25 2014

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.