Recombinant human TRAP/CD40L protein (Soluble, Animal Free) (ab179625)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 98% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant human TRAP/CD40L protein (Soluble, Animal Free)
See all TRAP/CD40L proteins and peptides -
Biological activity
HEK-blue™ CD40L Activity: ED50 ≤50 ng/ml; ≥ 2.0 x 104 units/mg.
-
Purity
>= 98 % SDS-PAGE.
Also determined by HPCL and spectroscopy at 280 nm. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLWLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL -
Predicted molecular weight
16 kDa -
Amino acids
113 to 261 -
Additional sequence information
Full length soluble form
-
-
Description
Recombinant human TRAP/CD40L protein (Soluble)
Specifications
Our Abpromise guarantee covers the use of ab179625 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
This product is produced with no animal-derived raw products, animal free equipment and animal free protocols.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 0.14% Sodium phosphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
General Info
-
Alternative names
- CD 40L
- CD154
- CD40 antigen ligand
see all -
Function
Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and an matrix metalloproteinases (MMP) inhibitor-sensitive pathway. -
Tissue specificity
Specifically expressed on activated CD4+ T-lymphocytes. -
Involvement in disease
Defects in CD40LG are the cause of X-linked immunodeficiency with hyper-IgM type 1 (HIGM1) [MIM:308230]; also known as X-linked hyper IgM syndrome (XHIM). HIGM1 is an immunoglobulin isotype switch defect characterized by elevated concentrations of serum IgM and decreased amounts of all other isotypes. Affected males present at an early age (usually within the first year of life) recurrent bacterial and opportunistic infections, including Pneumocystis carinii pneumonia and intractable diarrhea due to cryptosporidium infection. Despite substitution treatment with intravenous immunoglobulin, the overall prognosis is rather poor, with a death rate of about 10% before adolescence. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Post-translational
modificationsThe soluble form derives from the membrane form by proteolytic processing.
N-linked glycan is a mixture of high mannose and complex type. Glycan structure does not influence binding affinity to CD40.
Not O-glycosylated. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
Functional Studies - Recombinant human TRAP/CD40L protein (Soluble, Animal Free) (ab179625)Functional analysis of ab179625
-
SDS-PAGE - Recombinant human TRAP/CD40L protein (Soluble, Animal Free) (ab179625)SDS PAGE analysis of ab179625 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab179625 has not yet been referenced specifically in any publications.
