Recombinant mouse CXCL1/GRO alpha protein (ab202817)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse CXCL1/GRO alpha protein
See all CXCL1/GRO alpha proteins and peptides -
Biological activity
ab202817 is fully biologically active when compared to standard, determined by its ability to chemoattract total Human neutrophils using a concentration range of 10.0-100.0 ng/mL.
-
Purity
> 97 % SDS-PAGE.
Purity is determined by SDS-PAGE and HPLC analyses. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREA CLDPEAPLVQKIVQKMLKGVPK -
Predicted molecular weight
8 kDa -
Amino acids
25 to 96 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab202817 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride
Lyophilized from a 0.2 µM filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Reconstituted protein should be stored in working aliquots and stored at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
General Info
-
Alternative names
- C-X-C motif chemokine 1
- chemokine (C-X-C motif) ligand 1
- Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
see all -
Function
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsN-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab202817 has not yet been referenced specifically in any publications.
