Recombinant mouse DKK1 protein (Active) (ab281791)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: Functional Studies
Description
-
Product name
Recombinant mouse DKK1 protein (Active)
See all DKK1 proteins and peptides -
Biological activity
Fully biologically active measured by its ability to inhibit Wnt3-a induced alkaline phosphatase production by MC3T3-E1 mouse pre-osteoblast cells.
-
Purity
>= 95 % SDS-PAGE.
>=95% Purity by HPLC -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNY QPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCC PGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLT SKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKR KGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH -
Predicted molecular weight
29 kDa -
Amino acids
32 to 272 -
Additional sequence information
N-terminal glycine.
-
Specifications
Our Abpromise guarantee covers the use of ab281791 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.40
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose
Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- Dickkopf 1
- Dickkopf 1 homolog
- Dickkopf 1 like
see all -
Function
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. -
Tissue specificity
Placenta. -
Sequence similarities
Belongs to the dickkopf family. -
Domain
The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional Studies - Recombinant mouse DKK1 protein (Active) (ab281791)
Fully biologically active measured by its ability to inhibit Wnt3-a induced alkaline phosphatase production in C2C12 cells.
ED50 for this effect is ≤5.9 ng/ml corresponding to specific activity of 1.69 x 105 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot # GR3397988-1.
-
SDS-PAGE - Recombinant mouse DKK1 protein (Active) (ab281791)SDS-Page anaylsis of ab281791.
-
HPLC - Recombinant mouse DKK1 protein (Active) (ab281791)HPLC analysis of ab281791.
-
Mass Spectrometry - Recombinant mouse DKK1 protein (Active) (ab281791)Mass determination by ESI-TOF.
Predicted MW is 26212.64 Da. (+/- 10 Da by ESI-TOF). Observes MW is 26213.93 Da. Additional masses are due to residual O-glycans.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab281791 has not yet been referenced specifically in any publications.
