Recombinant mouse IL-12 protein (Active) (ab259419)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: < 0.005 Eu/µg
- Active: Yes
- Suitable for: Cell Culture, Functional Studies, MS, HPLC, SDS-PAGE
Description
-
Product name
Recombinant mouse IL-12 protein (Active)
See all IL-12 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of CTLL-2 cells is 1.96 ng/mL corresponding to a Specific Activity of 5.10 x 105 IU/mg.
-
Purity
>= 95 % SDS-PAGE.
>= 95 % HPLC. -
Endotoxin level
< 0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Amino Acid Sequence 1
-
Species
Mouse -
Sequence
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSG KTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKN KTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASL SAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYS TSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFV RIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS CSKWACVPCRVRS -
Predicted molecular weight
36 kDa -
Amino acids
23 to 335 -
Additional sequence information
Full length heterodimer. N-terminal glycine
-
Amino Acid Sequence 2
-
Species
Mouse -
Sequence
RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITR DQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGS IYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGET LRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA -
Predicted molecular weight
22 kDa -
Amino acids
23 to 215 -
Additional sequence information
Full length heterodimer. N-terminal glycine
-
Specifications
Our Abpromise guarantee covers the use of ab259419 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Cell Culture
Functional Studies
Mass Spectrometry
HPLC
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
Information available upon request.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with Phosphate Buffered saline.Reconstituted protein stable at -80C for 12 months or 4C for 1 week. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- CLMF
- CLMF p35
- CLMF p40
see all -
Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of CTLL-2 cells is 1.96 ng/mL corresponding to a Specific Activity of 5.10 x 105 IU/mg.
-
SDS-PAGE analysis of ab259419.
-
Purity: 100% (heterodimer)
The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.
-
M + 0. 9 Da (calc mass 21762.1) and M + 1.6 Da (calc mass 35848.4); heterodimer
The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab259419 has not yet been referenced specifically in any publications.