Recombinant mouse IL-6 protein (Active) (ab238300)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse IL-6 protein (Active)
See all IL-6 proteins and peptides -
Biological activity
B9 cell proliferation ED50 ≤ 50 pg/mL (≥ 2.0 x 10^7 units/mg). 7TD1 cell proliferation (Typical ED50 is < 1 ng/mL).
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGN SDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSY LEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNAL LTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT -
Predicted molecular weight
22 kDa -
Amino acids
25 to 211 -
Additional sequence information
Full length mature chain without signal peptide. Source: Genetically modified E.coli.
-
Specifications
Our Abpromise guarantee covers the use of ab238300 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
12 months from date of receipt when stored at -20°C to -80°C as supplied.
1 month when stored at 4°C after reconstituting as directed.
3 months when stored at -20°C to -80°C after reconstituting as directed. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
Lyophilized from a sterile (0.2 micron) filtered aqueous solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionSterile 10 mM HCl at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- Interleukin BSF 2
- B cell differentiation factor
- B cell stimulatory factor 2
see all -
Function
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. -
Involvement in disease
Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Post-translational
modificationsN- and O-glycosylated. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant mouse IL-6 protein (Active) (ab238300)
Recombinant mouse IL6 protein (Active) (ab238300) used at 1 µg.
4-20% Tris-Glycine gel, stained with Coomassie Blue.
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
-
Functional Studies - Recombinant mouse IL-6 protein (Active) (ab238300)B9 cell proliferation ED50 ≤ 50 pg/mL (≥ 2.0 x 10^7 units/mg).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab238300 has not yet been referenced specifically in any publications.