Recombinant mouse M-CSF protein (Active) (ab256080)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse M-CSF protein (Active)
See all M-CSF proteins and peptides -
Biological activity
NFS-60 cell proliferation. ≤10 ng/mL; ≥ 1.0 x 105 units/mg.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCY LKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQN KACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSR DVVTKP -
Predicted molecular weight
18 kDa -
Amino acids
33 to 187
-
Specifications
Our Abpromise guarantee covers the use of ab256080 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituents: 0.16% Sodium phosphate, 0.58% Sodium chloride
0.2 micron filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- Colony stimulating factor 1
- Colony stimulating factor 1 (macrophage)
- Colony stimulating factor macrophage specific
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. -
Post-translational
modificationsGlycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
Images
-
SDS-PAGE - Recombinant mouse M-CSF protein (Active) (ab256080)
SDS-PAGE analysis of ab256080 (1 μg) under non-reducing (Lane 1) and reducing (lane 2) condition. ab256080 is a homodimer with a predicted MW of 36.4 kDa (monomer is 18.2 kDa).
4-20% Tris-Glycine gel. Coomassie Blue staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab256080 has not yet been referenced specifically in any publications.
