Recombinant mouse M-CSF protein (Animal Free) (ab217461)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant mouse M-CSF protein (Animal Free)
See all M-CSF proteins and peptides -
Biological activity
Determined by its ability to stimulate the proliferation of murine M-NFS-60 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.
-
Purity
> 98 % SDS-PAGE.
assessed also by HPLC -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVD QEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATER LQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLE KDWNIFTKNCNNSFAKCSSRDVVTKP -
Predicted molecular weight
36 kDa -
Amino acids
33 to 187 -
Additional sequence information
homodimeric protein consisting of two 156 amino acid polypeptide subunits.
-
Specifications
Our Abpromise guarantee covers the use of ab217461 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- Colony stimulating factor 1
- Colony stimulating factor 1 (macrophage)
- Colony stimulating factor macrophage specific
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. -
Post-translational
modificationsGlycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab217461 has not yet been referenced specifically in any publications.
