Recombinant Mouse PD1 protein (Tagged) (ab271663)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 90% SDS-PAGE
- Tags: His tag C-Terminus, Avi tag C-Terminus
- Suitable for: WB, SDS-PAGE
Description
-
Product name
Recombinant Mouse PD1 protein (Tagged)
See all PD1 proteins and peptides -
Purity
>= 90 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSN QTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCG AISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ -
Molecular weight information
This protein runs at an apparent higher molecular weight due to glycosylation. -
Amino acids
25 to 167 -
Tags
His tag C-Terminus , Avi tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab271663 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.13% Sodium phosphate, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- CD279
- CD279 antigen
- hPD 1
see all -
Function
Possible cell death inducer, in association with other factors. -
Involvement in disease
Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Developmental stage
Induced at programmed cell death. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Mouse PD1 protein (Tagged) (ab271663)
SDS-PAGE analysis of 2 µg ab271663.
This protein runs at an apparent higher molecular weight due to glycosylation.
-
Western blot - Recombinant Mouse PD1 protein (Tagged) (ab271663)Recombinant Mouse PD1 protein (Tagged) (ab271663) as a positive control in WB.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab271663 has not yet been referenced specifically in any publications.