For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-mouse-peroxiredoxin-6-protein-ab195174.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Lipid metabolism
Share by email

Recombinant Mouse Peroxiredoxin 6 protein (ab195174)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)
  • Sandwich ELISA - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)
  • ELISA - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 99% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: SDS-PAGE, Sandwich ELISA

You may also be interested in

Biochemical
Product image
Zoledronate disodium salt, bisphosphonate bone resorption inhibitor (ab143738)
Primary
Product image
Anti-Peroxiredoxin 6 antibody [EPR3754] - BSA and Azide free (ab240057)
Protein
Product image
Recombinant Human JNK3 protein (ab45153)

View more associated products

Description

  • Product name

    Recombinant Mouse Peroxiredoxin 6 protein
    See all Peroxiredoxin 6 proteins and peptides
  • Purity

    > 99 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

    O08709
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HHHHHHGSGGSGPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSH PRDF TPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDIN AYNGETPTEKLPF PIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVF IFGPDKKLKLSILYPATTGRNF DEILRVVDSLQLTGTKPVATPVDWKK GESVMVVPTLSEEEAKQCFPKGVFTKELPS GKKYLRYTPQP
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      2 to 224
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab195174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Sandwich ELISA

  • Form

    Liquid
  • Additional notes

    Product was previously marketed under the MitoSciences sub-brand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.2% Monobasic dihydrogen potassium phosphate, 2.16% Sodium phosphate dibasic heptahydrate, 0.2% Potassium chloride, 8.06% Sodium chloride, 10% Trehalose

General Info

  • Alternative names

    • 1 Cys
    • 1 Cys peroxiredoxin
    • 1 Cys PRX
    • 1 cysPrx
    • 1-Cys peroxiredoxin
    • 1-Cys PRX
    • 24 kDa protein
    • 9430088D19Rik
    • AA690119
    • Acidic calcium independent phospholipase A2
    • Acidic calcium-independent phospholipase A2
    • aiPLA2
    • Antioxidant protein 2
    • AOP2
    • Aop2 rs3
    • Brp 12
    • Ciliary body glutathione peroxidase
    • CP 3
    • EC 1.11.1.15
    • EC 1.11.1.7
    • EC 3.1.1.
    • Epididymis secretory sperm binding protein Li 128m
    • GPx
    • HEL S 128m
    • KIAA0106
    • Liver 2D page spot 40
    • Ltw4
    • Lvtw 4
    • MGC46173
    • mKIAA0106
    • Non selenium glutathione peroxidase
    • Non-selenium glutathione peroxidase
    • NSGPx
    • ORF06
    • OTTHUMP00000032693
    • p29
    • Peroxiredoxin-6
    • Peroxiredoxin6
    • PHGPx
    • Phospholipase A2 lysosomal
    • PLA2
    • PRDX 6
    • Prdx5
    • PRDX6
    • Prdx6 rs3
    • PRDX6_HUMAN
    • PRX
    • Red blood cells page spot 12
    • Thiol specific antioxidant protein
    see all
  • Function

    Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
  • Sequence similarities

    Belongs to the ahpC/TSA family. Rehydrin subfamily.
    Contains 1 thioredoxin domain.
  • Cellular localization

    Cytoplasm. Lysosome. Cytoplasmic vesicle. Also found in lung secretory organelles.
  • Target information above from: UniProt accession P30041 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)
    SDS-PAGE - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)

    SDS PAGE gel stained with colloidal coomassie blue

    Lane 1: Ladder
    Lane 2: ab195174, 500ng

     

  • Sandwich ELISA - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)
    Sandwich ELISA - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)

    Example of data generated using ab195174 in a sandwich ELISA.

  • ELISA - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)
    ELISA - Recombinant Mouse Peroxiredoxin 6 protein (ab195174)

    Example of data generated using ab195174 in a direct ELISA.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab195174? Please let us know so that we can cite the reference in this datasheet.

ab195174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab195174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.