For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/recombinant-mouse-pgp95-protein-ab202233.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neurodegenerative disease Parkinson's disease Parkin / PARK
Share by email

Recombinant Mouse PGP9.5 protein (ab202233)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Mouse PGP9.5 protein (ab202233)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 90% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: MS, SDS-PAGE

    You may also be interested in

    Primary
    Product image
    Anti-PGP9.5 antibody [EPR4118] - Neuronal Marker (ab108986)
    ELISA
    Product image
    Mouse UCHL1 ELISA Kit (ab235641)
    Pair
    Product image
    Mouse UCHL1 Antibody Pair - BSA and Azide free (ab244197)

    View more associated products

    Description

    • Product name

      Recombinant Mouse PGP9.5 protein
      See all PGP9.5 proteins and peptides
    • Purity

      > 90 % SDS-PAGE.
      Purified using conventional chromatography techniques.
    • Expression system

      Escherichia coli
    • Accession

      Q9R0P9
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Mouse
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMGSMQLKPMEINPEMLNKVLAKLGVAGQWR FADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEELKGQEVSP KVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPE DRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDG RMPFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
      • Predicted molecular weight

        27 kDa including tags
      • Amino acids

        1 to 223
      • Tags

        His tag N-Terminus
      • Additional sequence information

        NP_035800.

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab202233 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Mass Spectrometry

      SDS-PAGE

    • Mass spectrometry

      MALDI-TOF
    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.4
      Constituents: 89% PBS, 0.02% DTT, 10% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • Epididymis luminal protein 117
      • Epididymis secretory protein Li 53
      • HEL 117
      • HEL S 53
      • NDGOA
      • Neuron cytoplasmic protein 9.5
      • OTTHUMP00000218137
      • OTTHUMP00000218139
      • OTTHUMP00000218140
      • OTTHUMP00000218141
      • Park 5
      • PARK5
      • PGP 9.5
      • PGP9.5
      • PGP95
      • Protein gene product 9.5
      • Ubiquitin C terminal esterase L1
      • Ubiquitin C terminal hydrolase
      • Ubiquitin C terminal hydrolase L1
      • Ubiquitin carboxyl terminal esterase L1
      • Ubiquitin carboxyl terminal hydrolase isozyme L1
      • Ubiquitin carboxyl-terminal hydrolase isozyme L1
      • Ubiquitin thioesterase L1
      • Ubiquitin thiolesterase
      • Ubiquitin thiolesterase L1
      • UCH-L1
      • UCHL1
      • UCHL1_HUMAN
      see all
    • Function

      Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. Also binds to free monoubiquitin and may prevent its degradation in lysosomes. The homodimer may have ATP-independent ubiquitin ligase activity.
    • Tissue specificity

      Found in neuronal cell bodies and processes throughout the neocortex (at protein level). Expressed in neurons and cells of the diffuse neuroendocrine system and their tumors. Weakly expressed in ovary. Down-regulated in brains from Parkinson disease and Alzheimer disease patients.
    • Involvement in disease

      Parkinson disease 5
      Neurodegeneration with optic atrophy, childhood-onset
    • Sequence similarities

      Belongs to the peptidase C12 family.
    • Post-translational
      modifications

      O-glycosylated.
    • Cellular localization

      Cytoplasm. Endoplasmic reticulum membrane. About 30% of total UCHL1 is associated with membranes in brain.
    • Target information above from: UniProt accession P09936 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Mouse PGP9.5 protein (ab202233)
      SDS-PAGE - Recombinant Mouse PGP9.5 protein (ab202233)

      15% SDS-PAGE analysis of ab202233 (3µg).

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab202233? Please let us know so that we can cite the reference in this datasheet.

    ab202233 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab202233.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.