Recombinant Rabbit IL-2 Protein (Active) (ab307411)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, MS
Description
-
Product name
Recombinant Rabbit IL-2 Protein (Active)
See all IL-2 proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent proliferation of CTLL-2 cells. ED50 is ≤ 1.35 ng/ml, corresponding to a specific activity of 7.4 x 105 units/mg.
-
Purity
>= 95 % HPLC.
SDS-PAGE >= 95% -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Rabbit -
Sequence
APTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSKLSRMLTFKFYMPKKV TELKHLQCLEEELKPLEEVLNLAQGKNSHGGNTRESISNINVTVLKLKGS ETFMCEYDETVTIVEFLNRWITFCQSIISASSS -
Predicted molecular weight
15 kDa -
Actual molecular weight
15 kDa -
Molecular weight information
Predicted MW is 15162.36 Da (+/- 10 Da by ESI-TOF). Observed MW is 15162.91 Da. -
Amino acids
21 to 153 -
Additional sequence information
N-terminal glycine (On N-Term)
-
Specifications
Our Abpromise guarantee covers the use of ab307411 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Mass Spectrometry
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.40
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionLyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.
General Info
-
Alternative names
- Aldesleukin
- IL 2
- IL-2
see all -
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. -
Involvement in disease
Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. -
Sequence similarities
Belongs to the IL-2 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Biological Activity - Recombinant Rabbit IL-2 Protein (Active) (ab307411)
Fully biologically active determined by the dose dependent proliferation of CTLL-2 cells. ED50 is ≤ 1.35 ng/ml, corresponding to a specific activity of 7.4 x 105 units/mg.
-
Mass Spectrometry - Recombinant Rabbit IL-2 Protein (ab307411)Mass determination by ESI-TOF. Predicted MW is 15162.36 Da (+/-10 Da by ESI-TOF). Observed MW is 15162.91 Da.
-
HPLC - Recombinant Rabbit IL-2 Protein (ab307411)HPLC analysis of ab307411
-
SDS-PAGE - Recombinant Rabbit IL-2 Protein (ab307411)SDS-PAGE analysis of ab307411
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab307411 has not yet been referenced specifically in any publications.
