Recombinant Rat IL-1 alpha Protein (Active) (ab290099)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, MS, HPLC
Description
-
Product name
Recombinant Rat IL-1 alpha Protein (Active)
See all IL-1 alpha proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent proliferation of D10S cells. The ED50 ≤ 5.07 pg/ml, corresponding to a specific activity of 1.97 x 108 units/mg.
-
Purity
>= 95 % HPLC.
SDS-PAGE >= 95% -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Rat -
Sequence
SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQ LEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETP KLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSM IDFQIS -
Predicted molecular weight
18 kDa -
Actual molecular weight
18 kDa -
Molecular weight information
Predicted MW is 17850.37 Da (+/- 10 Da by ESI-TOF). Observed MW is 17851.27 Da. -
Amino acids
115 to 270 -
Additional sequence information
N-terminal glycine; Mature form
-
Specifications
Our Abpromise guarantee covers the use of ab290099 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionLyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.
General Info
-
Alternative names
- BAF
- FAF
- Hematopoietin 1
see all -
Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. -
Sequence similarities
Belongs to the IL-1 family. -
Domain
The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function. -
Cellular localization
Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins. - Information by UniProt
Images
-
HPLC analysis of ab290099
-
Mass determination by ESI-TOF. Predicted MW is 17850.37 Da (+/- 10 Da by ESI-TOF). Observed MW is 17851.27 Da.
-
SDS-PAGE analysis of ab290099
-
Fully biologically active determined by the dose dependent proliferation of D10S cells. The ED50 ≤ 5.07 pg/ml, corresponding to a specific activity of 1.97 x 108 units/mg.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab290099 has not yet been referenced specifically in any publications.