Recombinant Rat IL-7 Protein (Active) (ab290092)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC, MS
Description
-
Product name
Recombinant Rat IL-7 Protein (Active)
See all IL-7 proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent proliferation of 2E8 cells.
ED50 is ≤ 16.3 ng/ml, corresponding to a specific activity of 6.1 x 104 units/mg.
-
Purity
>= 95 % HPLC.
SDS-PAGE >=95% -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Rat -
Sequence
DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTK EAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIK EQKKNDPCFLKRLLREIKTCWNKILKGSI -
Predicted molecular weight
15 kDa -
Actual molecular weight
15 kDa -
Molecular weight information
Predicted MW is 14936.21 Da (+/-10 Da by ESI-TOF). Observed MW is 14938.09 Da. -
Amino acids
26 to 154 -
Additional sequence information
N-terminal glycine
-
-
Description
Recombinant Rat IL-7 Protein
Specifications
Our Abpromise guarantee covers the use of ab290092 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
Mass Spectrometry
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionLyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.
General Info
-
Alternative names
- IL 7
- IL-7
- Il7
see all -
Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. -
Sequence similarities
Belongs to the IL-7/IL-9 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional Studies - Recombinant Rat IL-7 Protein (ab290092)
Fully biologically active determined by the dose dependent proliferation of 2E8 cells.
ED50 is ≤ 16.3 ng/ml, corresponding to a specific activity of 6.1 x 104 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3453026-1.
-
Mass Spectrometry - Recombinant Rat IL-7 Protein (ab290092)Mass determination by ESI-TOF. Predicted MW is 14936.21 Da (+/-10 Da by ESI-TOF). Observed MW is 14938.09 Da.
-
HPLC - Recombinant Rat IL-7 Protein (ab290092)HPLC analysis of ab290092
-
SDS-PAGE - Recombinant Rat IL-7 Protein (ab290092)SDS-PAGE analysis of ab290092
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab290092 has not yet been referenced specifically in any publications.
