Recombinant Rat M-CSF Protein (Active) (ab307410)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, MS
Description
-
Product name
Recombinant Rat M-CSF Protein (Active)
See all M-CSF proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent proliferation of M-NFS-60 cells. ED50 is ≤ 1.8 ng/ml, corresponding to a specific activity of 5.5 x 105 units/mg.
-
Purity
>= 95 % HPLC.
SDS-PAGE >= 95% -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Rat -
Sequence
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLK KAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEA CVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDV VTKPDCNC -
Predicted molecular weight
19 kDa -
Actual molecular weight
19 kDa -
Molecular weight information
Predicted MW is 18505.07 (+/- 10 Da by ESI-TOF). Observed MW is 18506.60 Da. -
Amino acids
33 to 190 -
Additional sequence information
N-terminal glycine (On N-Term)
-
Specifications
Our Abpromise guarantee covers the use of ab307410 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Mass Spectrometry
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.40
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionLyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.
General Info
-
Alternative names
- Colony stimulating factor 1
- Colony stimulating factor 1 (macrophage)
- Colony stimulating factor macrophage specific
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. -
Post-translational
modificationsGlycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Rat M-CSF Protein (ab307410)
SDS-PAGE analysis of ab307410
-
Biological Activity - Recombinant Rat M-CSF Protein (Active) (ab307410)Fully biologically active determined by the dose dependent proliferation of M-NFS-60 cells. ED50 is ≤ 1.8 ng/ml, corresponding to a specific activity of 5.5 x 105 units/mg.
-
Mass Spectrometry - Recombinant Rat M-CSF Protein (ab307410)Mass determination by ESI-TOF. Predicted MW is 18505.07 Da (+/-10 Da by ESI-TOF). Observed MW is 18506.60 Da.
-
HPLC - Recombinant Rat M-CSF Protein (ab307410)HPLC analysis of ab307410
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab307410 has not yet been referenced specifically in any publications.
