For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    products/proteins-peptides/streptavidin-hrp-ab7403.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Epitope Tags Conjugates
Share by email

Streptavidin (HRP) (ab7403)

  • Datasheet
  • SDS
Reviews (6)Q&A (14)References (149)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Streptavidin (HRP) (ab7403)
  • ELISA - Streptavidin (HRP) (ab7403)

Key features and details

  • Expression system: Native
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: Dot blot, ELISA, IHC-P, IHC-Fr, Immunomicroscopy, ICC, WB

You may also be interested in

ELISA
Product image
TMB ELISA Substrate (High Sensitivity) (ab171523)
Secondary
Product image
Donkey Anti-Mouse IgG H&L (Biotin) (ab208001)
Primary
Product image
Anti-Smad2 + Smad3 antibody [EPR19557] - BSA and Azide free (ab236030)

View more associated products

Description

  • Product name

    Streptavidin (HRP)
    See all Streptavidin proteins and peptides
  • Biological activity

    Binds to Biotin. Dissociation constant has not been measured.

  • Purity

    > 95 % SDS-PAGE.
    Chromatographically pure, a single band by SDS-PAGE. Streptavidin-HRP was prepared from chromatographically purified streptavidin.  Streptavidin Peroxidase conjugate was assayed by immunoelectrophoresis resulted in a single precipitin arc against anti-Peroxidase and anti-Streptavidin.
  • Expression system

    Native
  • Accession

    P22629
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Streptomyces avidinii
    • Sequence

      MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLG STFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWT VAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVG HDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
  • Conjugation

    HRP
  • Description

    Native Streptavidin protein (HRP)

Associated products

  • Substrate reagent

    • ABTS™, Peroxidase substrate (ab142041)

Specifications

Our Abpromise guarantee covers the use of ab7403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Dot blot

    ELISA

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemistry (Frozen sections)

    Immunomicroscopy

    Immunocytochemistry

    Western blot

  • Form

    Liquid
  • Additional notes

    Horseradish peroxidase is conjugated to the streptavidin tetramer at ~1:1 molar ratio.

    This product has been assayed against 1.0 µg of Biotinylated IgG in a standard capture ELISA using a peroxidase substrate as ABTS ab142041 as a substrate for 30 minutes at room temperature. A working dilution of 1:15,000 to 1:60,000 of the reconstitution concentration is suggested for this product. Optimal titers for other applications should be determined by the researcher.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Preservative: 0.01% Gentamicin sulphate
    Constituents: 0.424% Potassium phosphate, 0.87% Sodium chloride, BSA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • SA V1
    • SA V2
    • strepavidin
    • Streptavidin V1
    • Streptavidin V2
    see all
  • Relevance

    Streptavidin is a tetrameric protein purified from Streptomyces sp. that binds very tightly to the vitamin biotin with a Kd of ~ 10-14 mol/l. The high affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits.
  • Cellular localization

    Cytoplasmic

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Streptavidin (HRP) (ab7403)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Streptavidin (HRP) (ab7403)

    IHC image of Histone H1 staining in a section of formalin-fixed paraffin-embedded [human normal colon]*. The section was pre-treated using pressure cooker heat mediated antigen retrieval with sodium citrate buffer (pH6) for 30mins. The section was then incubated with ab11080, 1/1000 dilution, for 15 mins at room temperature. A goat anti-mouse biotinylated secondary antibody (ab6788, 1/1000 dilution), was used to detect the primary, and visualized using an HRP conjugated ABC system. Streptavidin HRP was used, ab7403 at a 1/10000 dilution. DAB was used as the chromogen (ab103723), diluted 1/100 and incubated for 10min at room temperature. The section was then counterstained with haematoxylin and mounted with DPX. The inset negative control image is taken from an identical assay without primary antibody.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    *Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre

  • ELISA - Streptavidin (HRP) (ab7403)
    ELISA - Streptavidin (HRP) (ab7403)

    The wells were coated with ab200699 at 1µg/ml at 50µl/well overnight at 4°C, followed by a 5% BSA blocking step for 2h RT. Human IgG3 (ab138703) was then added starting at 20 µg/ml and plasma/serum at 1:500 and gradually diluted 1:4, 50µl/well for 2h. Ab201248 was then added at 1:10,000 dilution, 50µl/well for 2h. A HRP-streptavidin (ab7403) was used at 1:10,000 dilution for 1h.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (149)

Publishing research using ab7403? Please let us know so that we can cite the reference in this datasheet.

ab7403 has been referenced in 149 publications.

  • Griffin TA  et al. Fibril treatment changes protein interactions of tau and α-synuclein in human neurons. J Biol Chem 299:102888 (2023). PubMed: 36634849
  • Zhang Y  et al. An antibody-based proximity labeling map reveals mechanisms of SARS-CoV-2 inhibition of antiviral immunity. Cell Chem Biol 29:5-18.e6 (2022). PubMed: 34672954
  • Yaghoubi A  et al. Prednisolone and mesenchymal stem cell preloading protect liver cell migration and mitigate extracellular matrix modification in transplanted decellularized rat liver. Stem Cell Res Ther 13:36 (2022). PubMed: 35090559
  • Xu Z  et al. Induction of tier-2 neutralizing antibodies in mice with a DNA-encoded HIV envelope native like trimer. Nat Commun 13:695 (2022). PubMed: 35121758
  • Zhang G  et al. Dynamic FMR1 granule phase switch instructed by m6A modification contributes to maternal RNA decay. Nat Commun 13:859 (2022). PubMed: 35165263
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review

Filter by Application

Filter by Ratings

1-6 of 6 Abreviews

Works good for staining

Excellent
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (PFA fixed)
Streptavidin HRP (1:1000) for IHC. Clear signal, no background.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted May 07 2021

Biotinylated protein detection ELISA

Excellent
Abreviews
Abreviews
abreview image
Application
ELISA
Capture : anti-target protein
Sample : Recombinant purified protein
1st Detection : Biotinylated anti-target protein
2nd Detection : Streptavidin HRP (1:4000)
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Sep 17 2020

WB for transfected biotinylated protein

Excellent
Abreviews
Abreviews
abreview image
Application
Western blot
I performed western blot with biotinylated proteins (BioID-tagged) transfected into HEK293T cells. The results clearly show a band at the expected molecular weight. Streptavidin (HRP) was used at 1:500 dilution in TBST with 2.5% BSA and incubated with the membrane 2 hours at room temperature.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Aug 07 2020

Northern blot

Excellent
Abreviews
Abreviews
abreview image
Application
Other - Do not use
The Biotin-labeled probes for RNA U6 were detected using streptavidin-HRP.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Jan 21 2020

Modified Biotin Switch assay for sulfhydration detection

Excellent
Abreviews
Abreviews
Application
Western blot
We performed modified biotin switch assay where the biotinylated sulfhydrated proteins were incubated with ab7403 - Streptavidin (HRP) for 1h at room temperature (1:100) and then immunoblotted for detection of sulfhydrated protein status.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted May 14 2018

Anti-CD9 sandwich ELISA

Excellent
Abreviews
Abreviews
abreview image
Application
ELISA
A standard sandwich ELISA experiment worked very well by use of ab7403 with 1/30,000 dilution.

Detailed protocol was described below.

*5 uL of human serum was separated with size exclusion chromatography into 10 fractions.
*1st antibody : anti-CD9 (Ancell Corporation)
*Blocking : 5% BSA in PBS
*2nd antibody : Biotinylated anti-CD9 (Ancell Corporation)

*HRP label : ab7403 - Streptavidin HRP, 1/30,000 dilution in 1% BSA/PBS, 30 min, RT

*1-Step Ultra TMB-ELISA Substrate Solution - Pierce
*Measure OD 450 nm
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Aug 20 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.