Overview

  • Product name

    Anti-ProDynorphin antibody
    See all ProDynorphin primary antibodies
  • Description

    Rabbit polyclonal to ProDynorphin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human ProDynorphin aa 195-245 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GDSMGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDP N


    Database link: P01213

  • Positive control

    • Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
    Dynorphin peptides differentially regulate the kappa opioid receptor. Dynorphin A(1-13) has a typical opiod activity, it is 700 times more potent than Leu-enkephalin.
    Leumorphin has a typical opiod activity and may have anti-apoptotic effect.
  • Involvement in disease

    Defects in PDYN are the cause of spinocerebellar ataxia type 23 (SCA23) [MIM:610245]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA23 is an adult-onset autosomal dominant form characterized by slowly progressive gait and limb ataxia, with variable additional features, including peripheral neuropathy and dysarthria.
  • Sequence similarities

    Belongs to the opioid neuropeptide precursor family.
  • Post-translational
    modifications

    The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADCA antibody
    • Alpha neoendorphin antibody
    • Beta neoendorphin antibody
    • Beta-neoendorphin-dynorphin antibody
    • Big Dyn antibody
    • Big dynorphin antibody
    • Dyn antibody
    • Dyn-A17 antibody
    • Dyn-B antibody
    • Dynorphin A antibody
    • Dynorphin A(1-13) antibody
    • Dynorphin A(1-17) antibody
    • Dynorphin A(1-8) antibody
    • Dynorphin B antibody
    • Dynorphin B(1-13) antibody
    • Dynorphin B-29 antibody
    • Enkephalin B antibody
    • Leu enkephalin antibody
    • Leumorphin antibody
    • Neoendorphin dynorphin enkephalin prepropeptide antibody
    • PDYN antibody
    • PDYN_HUMAN antibody
    • PENKB antibody
    • Preprodynorphin antibody
    • Preproenkephalin B antibody
    • Prodynorphin antibody
    • Proenkephalin B antibody
    • Rimorphin antibody
    • SCA23 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling ProDynorphin using ab217160 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up