Anti-Profilin 1 antibody [CL3524] (ab242369)
Key features and details
- Mouse monoclonal [CL3524] to Profilin 1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-Profilin 1 antibody [CL3524]
See all Profilin 1 primary antibodies -
Description
Mouse monoclonal [CL3524] to Profilin 1 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Profilin 1 aa 91-121.
Sequence:KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG
Database link: P07737 -
Positive control
- WB: Control siRNA transfected U-251 MG cell lysate. HeLa, HEK-293, A431 and HepG2 cell lysate. IHC-P: Human fallopian tube, tonsil, liver, kidney and testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
CL3524 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab242369 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. | |
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. -
Sequence similarities
Belongs to the profilin family. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
-
Database links
- Entrez Gene: 5216 Human
- Omim: 176610 Human
- SwissProt: P07737 Human
- Unigene: 494691 Human
-
Alternative names
- Actin binding protein antibody
- ALS18 antibody
- Epididymis tissue protein Li 184a antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
Formalin-fixed, paraffin-embedded human kidney tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.
-
All lanes : Anti-Profilin 1 antibody [CL3524] (ab242369) at 1 µg/ml
Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 2 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Lane 3 : A431 (Human epidermoid carcinoma cell line) cell lysate
Lane 4 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
Formalin-fixed, paraffin-embedded human liver tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
Formalin-fixed, paraffin-embedded human tonsil tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
Formalin-fixed, paraffin-embedded human testis tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.
-
All lanes : Anti-Profilin 1 antibody [CL3524] (ab242369) at 1 µg/ml
Lane 1 : Control siRNA transfected U-251 MG (Human brain glioma cell line) cell lysate
Lanes 2-3 : siRNA#1 transfected U-251 MG cell lysateLoading control is anti-GAPDH.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab242369 has not yet been referenced specifically in any publications.