Anti-Profilin 1 antibody [CL3524] (ab242369)

Submit a review Submit a question

Overview

  • Product name

    Anti-Profilin 1 antibody [CL3524]
    See all Profilin 1 primary antibodies

  • Description

    Mouse monoclonal [CL3524] to Profilin 1

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-Pmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human Profilin 1 aa 91-121.
    Sequence:

    KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG


    Database link: P07737

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Control siRNA transfected U-251 MG cell lysate. HeLa, HEK-293, A431 and HepG2 cell lysate. IHC-P: Human fallopian tube, tonsil, liver, kidney and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab242369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

  • Sequence similarities

    Belongs to the profilin family.

  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

  • Database links

    • Alternative names

      • Actin binding protein antibody
      • ALS18 antibody
      • Epididymis tissue protein Li 184a antibody
      • OTTHUMP00000125244 antibody
      • PFN 1 antibody
      • Pfn antibody
      • PFN1 antibody
      • PROF1_HUMAN antibody
      • Profilin I antibody
      • Profilin-1 antibody
      • Profilin1 antibody
      • ProfilinI antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human kidney tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      All lanes : Anti-Profilin 1 antibody [CL3524] (ab242369) at 1 µg/ml

      Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
      Lane 2 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
      Lane 3 : A431 (Human epidermoid carcinoma cell line) cell lysate
      Lane 4 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human liver tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human tonsil tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human testis tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      All lanes : Anti-Profilin 1 antibody [CL3524] (ab242369) at 1 µg/ml

      Lane 1 : Control siRNA transfected U-251 MG (Human brain glioma cell line) cell lysate
      Lanes 2-3 : siRNA#1 transfected U-251 MG cell lysate


      Loading control is anti-GAPDH.

    References

    ab242369 has not yet been referenced specifically in any publications.

    Publishing research using ab242369? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242369.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com