Anti-Profilin 1 antibody [CL3524] (ab242369)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
  • Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
  • Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)

Key features and details

  • Mouse monoclonal [CL3524] to Profilin 1
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG2a

Overview

  • Product name

    Anti-Profilin 1 antibody [CL3524]
    See all Profilin 1 primary antibodies

  • Description

    Mouse monoclonal [CL3524] to Profilin 1

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-Pmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human Profilin 1 aa 91-121.
    Sequence:

    KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG


    Database link: P07737
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Control siRNA transfected U-251 MG cell lysate. HeLa, HEK-293, A431 and HepG2 cell lysate. IHC-P: Human fallopian tube, tonsil, liver, kidney and testis tissue.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab242369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

  • Sequence similarities

    Belongs to the profilin family.

  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

  • Database links

    • Alternative names

      • Actin binding protein antibody
      • ALS18 antibody
      • Epididymis tissue protein Li 184a antibody
      • OTTHUMP00000125244 antibody
      • PFN 1 antibody
      • Pfn antibody
      • PFN1 antibody
      • PROF1_HUMAN antibody
      • Profilin I antibody
      • Profilin-1 antibody
      • Profilin1 antibody
      • ProfilinI antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human kidney tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      All lanes : Anti-Profilin 1 antibody [CL3524] (ab242369) at 1 µg/ml

      Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
      Lane 2 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
      Lane 3 : A431 (Human epidermoid carcinoma cell line) cell lysate
      Lane 4 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human liver tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human tonsil tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Profilin 1 antibody [CL3524] (ab242369)

      Formalin-fixed, paraffin-embedded human testis tissue stained for Profilin 1 with ab242369 at a 1:1000 dilution in immunohistochemical analysis.

    • Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      Western blot - Anti-Profilin 1 antibody [CL3524] (ab242369)
      All lanes : Anti-Profilin 1 antibody [CL3524] (ab242369) at 1 µg/ml

      Lane 1 : Control siRNA transfected U-251 MG (Human brain glioma cell line) cell lysate
      Lanes 2-3 : siRNA#1 transfected U-251 MG cell lysate


      Loading control is anti-GAPDH.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab242369? Please let us know so that we can cite the reference in this datasheet.

    ab242369 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242369.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com