Overview

  • Product name

  • Description

    Rabbit polyclonal to Profilin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Profilin aa 1-133. (Mercurialis annua; 6xHis-SUMO tag on N-terminus).
    Sequence:

    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEIT GIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTG QLVFGIYEEPVTPGQCNMVVERLGDYLIEQGM


    Database link: O49894

  • Positive control

    • WB: Recombinant Mercurialis annua Profilin protein with 6xHis-SUMO tag on N-terminus.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 31 kDa (predicted molecular weight: 14 kDa).

Target

  • Relevance

    Function: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity).

Images

  • All lanes : Anti-Profilin antibody (ab225944) at 1/500 dilution

    Lane 1 : Recombinant Mercurialis annua Profilin protein with 6xHis-SUMO tag on N-terminus at 0.08 µg
    Lane 2 : Recombinant Mercurialis annua Profilin protein with 6xHis-SUMO tag on N-terminus at 0.04 µg
    Lane 3 : Recombinant Mercurialis annua Profilin protein with 6xHis-SUMO tag on N-terminus at 0.02 µg
    Lane 4 : Recombinant Mercurialis annua Profilin protein with 6xHis-SUMO tag on N-terminus at 0.01 µg

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 14 kDa
    Observed band size: 31 kDa
    why is the actual band size different from the predicted?



    Predicted MW of recombinant protein: 31 kDa

References

ab225944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up