Overview

  • Product name

    Anti-Progesterone Receptor antibody - C-terminal
    See all Progesterone Receptor primary antibodies
  • Description

    Rabbit polyclonal to Progesterone Receptor - C-terminal
  • Host species

    Rabbit
  • Specificity

    No cross reactivity with other proteins.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Chicken, Dog, Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Progesterone Receptor aa 595-933 (C terminal). (E. coli-derived).
    Sequence:

    MEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNK VRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSI EPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHI DDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSF YSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEM RSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNT FIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK


    Database link: P06401

  • Positive control

    • HeLa, MCF7 and SKOV Whole Cell Lysates; Rat and Mouse Brain Tissue Lysates; Human Lung, Mammary and Intestinal Cancer Tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab191138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 99 kDa.

Target

  • Function

    The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC/MAPK signaling on hormone stimulation.
    Isoform A: inactive in stimulating c-Src/MAPK signaling on hormone stimulation.
    Isoform 4: Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Post-translational
    modifications

    Phosphorylated on multiple serine sites. Several of these sites are hormone-dependent. Phosphorylation on Ser-294 occurs preferentially on isoform B, is highly hormone-dependent and modulates ubiquitination and sumoylation on Lys-388. Phosphorylation on Ser-102 and Ser-345 also requires induction by hormone. Basal phosphorylation on Ser-81, Ser-162, Ser-190 and Ser-400 is increased in response to progesterone and can be phosphorylated in vitro by the CDK2-A1 complex. Increased levels of phosphorylation on Ser-400 also in the presence of EGF, heregulin, IGF, PMA and FBS. Phosphorylation at this site by CDK2 is ligand-independent, and increases nuclear translocation and transcriptional activity. Phosphorylation at Ser-162 and Ser-294, but not at Ser-190, is impaired during the G(2)/M phase of the cell cycle. Phosphorylation on Ser-345 by ERK1/2 MAPK is required for interaction with SP1.
    Sumoylation is hormone-dependent and represses transcriptional activity. Sumoylation on all three sites is enhanced by PIAS3. Desumoylated by SENP1. Sumoylation on Lys-388, the main site of sumoylation, is repressed by ubiquitination on the same site, and modulated by phosphorylation at Ser-294.
    Ubiquitination is hormone-dependent and represses sumoylation on the same site. Promoted by MAPK-mediated phosphorylation on Ser-294.
    Palmitoylated by ZDHHC7 and ZDHHC21. Palmitoylation is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation.
  • Cellular localization

    Nucleus. Cytoplasm. Nucleoplasmic shuttling is both homone- and cell cycle-dependent. On hormone stimulation, retained in the cytoplasm in the G(1) and G(2)/M phases; Mitochondrion outer membrane and Nucleus. Cytoplasm. Mainly nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • NR3C3 antibody
    • Nuclear receptor subfamily 3 group C member 3 antibody
    • PGR antibody
    • PR antibody
    • PRA antibody
    • PRB antibody
    • PRGR_HUMAN antibody
    • Progesterone receptor antibody
    • Progestin receptor form A antibody
    • Progestin receptor form B antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human Intestinal Cancer Tissue labeling Progesterone Receptor with ab191138 at 1 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human Mammary Cancer Tissue labeling Progesterone Receptor with ab191138 at 1 µg/ml.

  • Anti-Progesterone Receptor antibody - C-terminal (ab191138) at 0.1 µg/ml + Human T-47D whole cell lysates. at 50 µg with 5% non-fat milk/ TBS for 1.5 hours at room temperature.

    Secondary
    Goat anti-Rabbit IgG-HRP for 1.5 hours at room temperature at 1/10000 dilution

    Performed under reducing conditions.

    Predicted band size: 99 kDa
    Additional bands at: 90 kDa (possible isoform), 99 kDa (possible isoform)

  • Immunohistochemical analysis of paraffin-embedded Human Lung Cancer Tissue labeling Progesterone Receptor with ab191138 at 1 µg/ml.

References

ab191138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Pig Tissue sections (uterus)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: high Target retrival solution
Permeabilization
No
Specification
uterus
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5µg/mL · Temperature: 25°C
Fixative
Formaldehyde

Frau. Ines Kleiber-Schaaf

Verified customer

Submitted Jul 11 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Dog Tissue sections (mammary gland tumor)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA
Permeabilization
Yes - 3% H2O2
Specification
mammary gland tumor
Fixative
Formaldehyde

Ms. Hyojeong Han

Verified customer

Submitted Feb 12 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Dog Tissue sections (uterus)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate ph 6,0
Permeabilization
No
Specification
uterus
Blocking step
Background Block (CELL MARQUE) as blocking agent for 20 minute(s) · Concentration: 100% · Temperature: 25°C
Fixative
Formaldehyde

Prof. ALESSANDRA MEDEIROS

Verified customer

Submitted Oct 15 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Dog Tissue sections (uterus)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10 mM citrate, pH6.0
Permeabilization
No
Specification
uterus
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted May 23 2016

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10 mM citrate, pH6.0
Permeabilization
No
Specification
testis
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Aug 13 2015

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (placenta)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10 mM citrate, pH6.0
Permeabilization
No
Specification
placenta
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jul 17 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up