Anti-Progesterone Receptor antibody - C-terminal (ab191138)
Key features and details
- Rabbit polyclonal to Progesterone Receptor - C-terminal
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Progesterone Receptor antibody - C-terminal
See all Progesterone Receptor primary antibodies -
Description
Rabbit polyclonal to Progesterone Receptor - C-terminal -
Host species
Rabbit -
Specificity
No cross reactivity with other proteins. -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rabbit, Chicken, Dog, Chimpanzee, Gorilla, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human Progesterone Receptor aa 595-933 (C terminal). (E. coli-derived).
Sequence:MEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNK VRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSI EPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHI DDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSF YSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEM RSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNT FIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Database link: P06401 -
Positive control
- HeLa, MCF7 and SKOV Whole Cell Lysates; Rat and Mouse Brain Tissue Lysates; Human Lung, Mammary and Intestinal Cancer Tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.025% Sodium azide
Constituents: 0.45% Sodium chloride, 0.1% Dibasic monohydrogen sodium phosphate -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab191138 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 99 kDa. |
Target
-
Function
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC/MAPK signaling on hormone stimulation.
Isoform A: inactive in stimulating c-Src/MAPK signaling on hormone stimulation.
Isoform 4: Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone. -
Sequence similarities
Belongs to the nuclear hormone receptor family. NR3 subfamily.
Contains 1 nuclear receptor DNA-binding domain. -
Domain
Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. -
Post-translational
modificationsPhosphorylated on multiple serine sites. Several of these sites are hormone-dependent. Phosphorylation on Ser-294 occurs preferentially on isoform B, is highly hormone-dependent and modulates ubiquitination and sumoylation on Lys-388. Phosphorylation on Ser-102 and Ser-345 also requires induction by hormone. Basal phosphorylation on Ser-81, Ser-162, Ser-190 and Ser-400 is increased in response to progesterone and can be phosphorylated in vitro by the CDK2-A1 complex. Increased levels of phosphorylation on Ser-400 also in the presence of EGF, heregulin, IGF, PMA and FBS. Phosphorylation at this site by CDK2 is ligand-independent, and increases nuclear translocation and transcriptional activity. Phosphorylation at Ser-162 and Ser-294, but not at Ser-190, is impaired during the G(2)/M phase of the cell cycle. Phosphorylation on Ser-345 by ERK1/2 MAPK is required for interaction with SP1.
Sumoylation is hormone-dependent and represses transcriptional activity. Sumoylation on all three sites is enhanced by PIAS3. Desumoylated by SENP1. Sumoylation on Lys-388, the main site of sumoylation, is repressed by ubiquitination on the same site, and modulated by phosphorylation at Ser-294.
Ubiquitination is hormone-dependent and represses sumoylation on the same site. Promoted by MAPK-mediated phosphorylation on Ser-294.
Palmitoylated by ZDHHC7 and ZDHHC21. Palmitoylation is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation. -
Cellular localization
Nucleus. Cytoplasm. Nucleoplasmic shuttling is both homone- and cell cycle-dependent. On hormone stimulation, retained in the cytoplasm in the G(1) and G(2)/M phases; Mitochondrion outer membrane and Nucleus. Cytoplasm. Mainly nuclear. - Information by UniProt
-
Database links
- Entrez Gene: 396198 Chicken
- Entrez Gene: 403621 Dog
- Entrez Gene: 5241 Human
- Entrez Gene: 18667 Mouse
- Entrez Gene: 100009094 Rabbit
- Omim: 607311 Human
- SwissProt: A7X8B3 Chimpanzee
- SwissProt: A7X8B7 Gorilla
see all -
Alternative names
- NR3C3 antibody
- Nuclear receptor subfamily 3 group C member 3 antibody
- PGR antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Progesterone Receptor antibody - C-terminal (ab191138)Immunohistochemical analysis of paraffin-embedded Human Intestinal Cancer Tissue labeling Progesterone Receptor with ab191138 at 1 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Progesterone Receptor antibody - C-terminal (ab191138)Immunohistochemical analysis of paraffin-embedded Human Mammary Cancer Tissue labeling Progesterone Receptor with ab191138 at 1 µg/ml.
-
Western blot - Anti-Progesterone Receptor antibody - C-terminal (ab191138)Anti-Progesterone Receptor antibody - C-terminal (ab191138) at 0.1 µg/ml + Human T-47D whole cell lysates. at 50 µg with 5% non-fat milk/ TBS for 1.5 hours at room temperature.
Secondary
Goat anti-Rabbit IgG-HRP for 1.5 hours at room temperature at 1/10000 dilution
Performed under reducing conditions.
Predicted band size: 99 kDa
Additional bands at: 90 kDa (possible isoform), 99 kDa (possible isoform) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Progesterone Receptor antibody - C-terminal (ab191138)Immunohistochemical analysis of paraffin-embedded Human Lung Cancer Tissue labeling Progesterone Receptor with ab191138 at 1 µg/ml.
Protocols
Datasheets and documents
References
ab191138 has not yet been referenced specifically in any publications.
