Overview

  • Product name

  • Description

    Rabbit polyclonal to Prohibitin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Prohibitin aa 1-272.
    Sequence:

    MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVV GEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVA SQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQV SDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQ LSRSRNITYLPAGQSVLLQLPQ


    Database link: P35232

  • Positive control

    • WB: Mouse brain lysate; Raji whole cell lysate. IP: HEK-293 whole cell lysates. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
IHC-P 1/10 - 1/100.
WB 1/200 - 1/1000. Predicted molecular weight: 30 kDa.

Target

Images

  • Anti-Prohibitin antibody (ab235962) at 1/200 dilution + Mouse brain lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 30 kDa

  • Anti-Prohibitin antibody (ab235962) at 1/200 dilution + Raji (human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 30 kDa

  • Prohibitin was immunoprecipitated from 0.5 mg HEK-293 (human epithelial cell line from embryonic kidney) whole cell extract with ab235962 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP (1 μg) in HEK-293 whole cell lysate.

    Lane 2: ab235962 IP in HEK-293 whole cell extract.

    Lane 3: HEK-293 whole cell lysate 10 μg (Input).

  • Prohibitin was immunoprecipitated from 0.5 mg HEK-293 (human epithelial cell line from embryonic kidney) whole cell extract with ab235962 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP (1 μg) in HEK-293 whole cell lysate.

    Lane 2: ab235962 IP in HEK-293 whole cell extract.

    Lane 3: HEK-293 whole cell lysate 10 μg (Input).

  • Paraffin-embedded human kidney tissue stained for Prohibitin using ab235962 at 1/20 dilution in immunohistochemical analysis.

References

ab235962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up