Overview

  • Product name

    Anti-Prokineticin 2/PK2 antibody
    See all Prokineticin 2/PK2 primary antibodies
  • Description

    Rabbit polyclonal to Prokineticin 2/PK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Prokineticin 2/PK2 aa 70-129 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTS FNRFICLAQK


    Database link: Q9HC23

  • Positive control

    • Rat brain tissue.
  • General notes

     This product was previously labelled as Prokineticin 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle.
  • Tissue specificity

    Expressed in the testis and, at low levels, in the small intestine.
  • Involvement in disease

    Defects in PROK2 are the cause of Kallmann syndrome type 4 (KAL4) [MIM:610628]; also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. KAL4 patients have variable degrees of olfactory and reproductive dysfunction, but do not show any of the occasional clinical anomalies reported in Kallmann syndrome such as renal agenesis, cleft lip/palate, selective tooth agenesis, and bimanual synkinesis.
  • Sequence similarities

    Belongs to the AVIT (prokineticin) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BV8 antibody
    • Bv8 homolog antibody
    • MIT1 antibody
    • PK2 antibody
    • PROK2 antibody
    • PROK2_HUMAN antibody
    • Prokineticin-2 antibody
    • Protein Bv8 homolog antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling Prokineticin 2/PK2 with ab203882 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab203882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up