Overview

  • Product name

    Anti-Prolactin Receptor/PRL-R antibody
    See all Prolactin Receptor/PRL-R primary antibodies
  • Description

    Rabbit polyclonal to Prolactin Receptor/PRL-R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Sheep
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Prolactin Receptor/PRL-R aa 25-234 (N terminal). (Expressed in E.coli)
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFQSPPEKPKLVKCRS PGKETFTCWWEPGADGGLPTNYTLTYHKEGETLIHECPDYKTGGPNSCYF SKKHTSIWKMYVITVNAINQMGISSSDPLYVHVTYIVEPEPPANLTLELK HPEDRKPYLWIKWSPPTMTDVKSGWFIIQYEIRLKPEKATDWETHFTLKQ TQLKIFNLYPGQKYLVQIRCKPDHGYWSEWSPESSIQIPNDFPVKD


    Database link: Q28172

  • Positive control

    • WB: Recombinant cow Prolactin Receptor/PRL-R; cow serum.
  • General notes

    Previously labelled as Prolactin Receptor. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    This is a receptor for the anterior pituitary hormone prolactin (PRL). Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.
  • Tissue specificity

    Expressed in breast, placenta, kidney, liver and pancreas.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI987712 antibody
    • CLONE SPM213 antibody
    • CPRLP antibody
    • Delta 4-delta 7/11 truncated prolactin receptor antibody
    • Delta 4-SF1b truncated prolactin receptor antibody
    • HPRL antibody
    • hPRL receptor antibody
    • hPRLrI antibody
    • Lactogen receptor antibody
    • MFAB antibody
    • MGC105486 antibody
    • OPR antibody
    • OTTHUMP00000115998 antibody
    • Pr-1 antibody
    • Pr-3 antibody
    • PRL R antibody
    • PRL-R antibody
    • PRLR antibody
    • Prlr-rs1 antibody
    • PRLR_HUMAN antibody
    • Prolactin receptor a antibody
    • Prolactin receptor antibody
    • Prolactin receptor delta 7/11 antibody
    • RATPRLR antibody
    • Secreted prolactin binding protein antibody
    • Truncated testis-specific box 1-C prolactin receptor antibody
    • wu:fj65c07 antibody
    see all

Images

  • Anti-Prolactin Receptor/PRL-R antibody (ab231140) at 2 µg/ml + Bovine Serum.

    Developed using the ECL technique.

    Predicted band size: 65 kDa

  • Anti-Prolactin Receptor/PRL-R antibody (ab231140) at 2 µg/ml + Recombinant cow Prolactin Receptor/PRL-R protein.

    Developed using the ECL technique.

    Predicted band size: 65 kDa

References

ab231140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up