Overview

  • Product name

    Anti-Prolactin/PRL antibody
    See all Prolactin/PRL primary antibodies
  • Description

    Rabbit polyclonal to Prolactin/PRL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Prolactin/PRL aa 180-227 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC


    Database link: P01236

  • Positive control

    • Rat brain and human placenta tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Prolactin/PRL with ab216501 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human placenta tissue labeling Prolactin/PRL with ab216501 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab216501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (mouse placenta)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 1x citrate retrieval buffer
Permeabilization
No
Specification
mouse placenta
Blocking step
1x Powerblock as blocking agent for 20 minute(s) · Concentration: 10% · Temperature: 23°C
Fixative
10% formalin

Paula Austin

Verified customer

Submitted Dec 09 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up