Overview

  • Product name

    Anti-Prolactin/PRL antibody
    See all Prolactin/PRL primary antibodies
  • Description

    Rabbit polyclonal to Prolactin/PRL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Human, Rhesus monkey
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Prolactin/PRL aa 29-227. (Expressed in E.coli).
    Sequence:

    LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGF ITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVT EVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVW SGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC


    Database link: P01236

  • Positive control

    • WB: Recombinant human Prolactin/PRL protein; Pig large intestine lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231240 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Relevance

    Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Decidual prolactin antibody
    • GHA1 antibody
    • Growth hormone A1 antibody
    • Lactogenic hormone antibody
    • Luteotropic hormone antibody
    • Mammotropin antibody
    • PRL antibody
    • Prolactin antibody
    • Prolactin precursor antibody
    see all

Images

  • Anti-Prolactin/PRL antibody (ab231240) at 1 µg/ml + Pig large intestine tissue lysate

    Secondary
    HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

  • Anti-Prolactin/PRL antibody (ab231240) at 1 µg/ml + Recombinant human Prolactin/PRL protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

References

ab231240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up