Overview

  • Product name

    Anti-Properdin/PFC antibody
    See all Properdin/PFC primary antibodies
  • Description

    Rabbit polyclonal to Properdin/PFC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Properdin/PFC aa 36-85 (N terminal).
    Sequence:

    YEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWST


    Database link: NP_002612

  • Positive control

    • Human fetal brain lysate
  • General notes

     This product was previously labelled as Properdin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab94597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes.
  • Involvement in disease

    Defects in CFP are the cause of properdin deficiency (PFD) [MIM:312060]. PFD results in higher susceptibility to bacterial infections; especially to meningococcal infections. Three phenotypes have been reported: complete deficiency (type I), incomplete deficiency (type II), and dysfunction of properdin (type III).
  • Sequence similarities

    Contains 6 TSP type-1 domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BFD antibody
    • CFP antibody
    • Complement factor P antibody
    • Complement factor properdin antibody
    • Factor P antibody
    • PFC antibody
    • PFD antibody
    • PROP_HUMAN antibody
    • Properdin antibody
    • Properdin P factor complement antibody
    see all

Images

  • Anti-Properdin/PFC antibody (ab94597) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 51 kDa



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human tonsil tissue labelling Properdin/PFC with ab94597 at 5µg/ml.

References

ab94597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up