Anti-PROSC antibody (ab224453)
Key features and details
- Rabbit polyclonal to PROSC
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PROSC antibody
See all PROSC primary antibodies -
Description
Rabbit polyclonal to PROSC -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human PROSC aa 190-258.
Sequence:LSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTN VRIGSTIFGERDYSKKPTP
Database link: O94903 -
Positive control
- IHC-P: Human placenta tissue. WB: RT4 and U-251 MG cell lysate; human liver and tonsil tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224453 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 30 kDa. | |
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the UPF0001 family. - Information by UniProt
-
Database links
- Entrez Gene: 11212 Human
- Entrez Gene: 100173881 Orangutan
- Omim: 604436 Human
- SwissProt: O94903 Human
- SwissProt: Q5R4Z1 Orangutan
- Unigene: 304792 Human
- Unigene: 608177 Human
-
Alternative names
- FLJ11861 antibody
- Proline synthase co-transcribed bacterial homolog protein antibody
- Proline synthetase co transcribed bacterial homolog antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PROSC antibody (ab224453)
Paraffin embedded human placenta tissue stained for PROSC with ab224453 (1/20 dilution) in immunohistochemical analysis.
-
All lanes : Anti-PROSC antibody (ab224453) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 30 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224453 has not yet been referenced specifically in any publications.