Anti-Prostaglandin E Synthase / MPGES-1 antibody (ab168621)

Overview

  • Product name
    Anti-Prostaglandin E Synthase / MPGES-1 antibody
    See all Prostaglandin E Synthase / MPGES-1 primary antibodies
  • Description
    Mouse polyclonal to Prostaglandin E Synthase / MPGES-1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Full length protein corresponding to Human Prostaglandin E Synthase/ MPGES-1 aa 1-152.
    Sequence:

    MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDA LRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAW MHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAAR HL


    Database link: NP_004869.1

  • Positive control
    • HeLa cells; Prostaglandin E Synthase transfected 293T cell lysate; HeLa cell lysate.
  • General notes

    Previously labelled as Prostaglandin E Synthase

Properties

Applications

Our Abpromise guarantee covers the use of ab168621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
  • Sequence similarities
    Belongs to the MAPEG family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Glutathione S transferase 1 like 1 antibody
    • MGC10317 antibody
    • MGST IV antibody
    • MGST1 L1 antibody
    • MGST1 like 1 antibody
    • MGST1-L1 antibody
    • MGST1L1 antibody
    • MGSTIV antibody
    • Microsomal glutathione S transferase 1 like 1 antibody
    • Microsomal glutathione S-transferase 1-like 1 antibody
    • Microsomal prostaglandin E synthase 1 antibody
    • Microsomal prostaglandin E synthase 1 antibody
    • mPGES 1 antibody
    • MPGES antibody
    • mPGES-1 antibody
    • p53 induced apoptosis protein 12 antibody
    • p53 induced gene 12 antibody
    • p53 induced gene 12 protein antibody
    • p53-induced gene 12 protein antibody
    • PGES antibody
    • PIG 12 antibody
    • PIG12 antibody
    • PP 102 antibody
    • PP 1294 antibody
    • PP102 antibody
    • PP1294 antibody
    • Prostaglandin E synthase antibody
    • PTGES antibody
    • PTGES_HUMAN antibody
    • TP53I12 antibody
    • Tumor protein p53 inducible protein 12 antibody
    see all

Images

  • Anti-Prostaglandin E Synthase / MPGES-1 antibody (ab168621) at 1 µg/ml + HeLa cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 17 kDa

  • All lanes : Anti-Prostaglandin E Synthase / MPGES-1 antibody (ab168621) at 1 µg/ml

    Lane 1 : Prostaglandin E Synthase / MPGES-1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 17 kDa

  • Immunofluorescent analysis of HeLa cells labeling Prostaglandin E Synthase / MPGES-1 with ab168621 at 10 µg/ml.

References

ab168621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up