Overview

  • Product name

    Anti-Prosurfactant Protein B antibody
  • Description

    Rabbit polyclonal to Prosurfactant Protein B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Prosurfactant Protein B aa 20-193. (Expressed in E.coli).
    Sequence:

    GAAITSASSLECAQGPQFWCQSLEHAVQCRALGHCLQEVWGHAGANDLCQ ECEDIVHLLTKMTKEDAFQEAIRKFLEQECDILPLKLLVPRCRQVLDVYL PLVIDYFQSQINPKAICNHVGLCPRGQAKPEQNPGMPDAVPNPLLDKLVL PVLPGALLARPGPHTQDFSEQQLP


    Database link: P50405

  • Positive control

    • IHC-P: Mouse liver and lung tissues. WB: Mouse liver lysate; Recombinant mouse Prosurfactant Protein B protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
  • Involvement in disease

    Pulmonary surfactant metabolism dysfunction 1
    Respiratory distress syndrome in premature infants
  • Sequence similarities

    Contains 1 saposin A-type domain.
    Contains 3 saposin B-type domains.
  • Cellular localization

    Secreted, extracellular space, surface film.
  • Information by UniProt
  • Database links

  • Alternative names

    • 18 kDa pulmonary-surfactant protein antibody
    • 6 kDa protein antibody
    • PSP B antibody
    • PSPB antibody
    • PSPB_HUMAN antibody
    • Pulmonary surfactant apoprotein PSP-B antibody
    • Pulmonary surfactant-associated protein B antibody
    • Pulmonary surfactant-associated protein, 18-KD antibody
    • Pulmonary surfactant-associated proteolipid SPL(Phe) antibody
    • SFTB3 antibody
    • SFTP3 antibody
    • SFTPB antibody
    • SMDP1 antibody
    • SP B antibody
    • SP-B antibody
    • SPB antibody
    • surfactant protein B antibody
    • Surfactant, pulmonary-associated protein B antibody
    • surfactant-associated protein, pulmonary, 3 antibody
    see all

Images

  • Paraffin-embedded mouse liver tissue stained for Prosurfactant Protein B using ab231551 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse lung tissue stained for Prosurfactant Protein B using ab231551 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Prosurfactant Protein B antibody (ab231551) at 2 µg/ml + Recombinant mouse Prosurfactant Protein B protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 42 kDa

  • Anti-Prosurfactant Protein B antibody (ab231551) at 2 µg/ml + Mouse liver lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 42 kDa

References

ab231551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up