Overview

  • Product name

    Anti-Proteasome 19S S4/PSMC1 antibody
    See all Proteasome 19S S4/PSMC1 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 19S S4/PSMC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Drosophila melanogaster
  • Immunogen

    Recombinant fragment corresponding to Human Proteasome 19S S4/PSMC1 aa 295-436.
    Sequence:

    YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRP GRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGAD IKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE


    Database link: P62191

  • Positive control

    • WB: EFO-21, NIH/3T3, NBT-II and PC-12 cell lysates. IHC-P: Human testis tissue. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as Proteasome 19S S4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 49 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-Proteasome 19S S4/PSMC1 antibody (ab223765) at 1/250 dilution + EFO-21 whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 49 kDa

  • Paraffin-embedded human testis tissue stained for Proteasome 19S S4/PSMC1 using ab223765 at 1/1000 dilution in immunohistochemical analysis.

  • All lanes : Anti-Proteasome 19S S4/PSMC1 antibody (ab223765) at 1/250 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II whole cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 49 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Proteasome 19S S4/PSMC1 (green) using ab223765 at 4 µg/ml in ICC/IF.

References

ab223765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up