Overview

  • Product name

    Anti-Proteasome 19S S5A/ASF antibody
    See all Proteasome 19S S5A/ASF primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 19S S5A/ASF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Non human primates, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome 19S S5A/ASF aa 327-377.
    Sequence:

    DVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDK K


    Database link: NP_002801.1

  • Positive control

    • 293T, HeLa and Jurkat whole cell lysate.
  • General notes

    Previously labelled as Proteasome 19S S5A. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antibody concentration was determined by extinction coefficient: absorbance at 280 nm of 1.4 equals 1.0 mg of IgG.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 40 kDa.
IP Use at 2-10 µg/mg of lysate.
IHC-P 1/1000 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.
  • Sequence similarities

    Belongs to the proteasome subunit S5A family.
    Contains 2 UIM (ubiquitin-interacting motif) repeats.
    Contains 1 VWFA domain.
  • Domain

    The 2 UIM motifs are involved in the binding to a multi-ubiquitin chain in a cooperative way.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • 26S protease subunit S5a antibody
    • 26S proteasome non ATPase regulatory subunit 4 antibody
    • 26S proteasome non-ATPase regulatory subunit 4 antibody
    • 26S proteasome regulatory subunit rpn10 antibody
    • 26S proteasome regulatory subunit S5A antibody
    • AF 1 antibody
    • AF antibody
    • AF1 antibody
    • Angiocidin antibody
    • Antisecretory factor 1 antibody
    • ASF antibody
    • DS5a antibody
    • MCB 1 antibody
    • MCB1 antibody
    • Multiubiquitin chain binding protein antibody
    • Multiubiquitin chain-binding protein antibody
    • OTTHUMP00000059963 antibody
    • Prosome macropain antibody
    • Proteasome (prosome macropain) 26S subunit non ATPase 4 antibody
    • Proteasome 19S S5A antibody
    • Proteasome 26S non ATPase subunit 4 antibody
    • Proteasome 26S subunit non ATPase 4 antibody
    • PSMD 4 antibody
    • Psmd4 antibody
    • PSMD4_HUMAN antibody
    • pUB R5 antibody
    • pUBR5 antibody
    • Rpn 10 antibody
    • Rpn10 antibody
    • RPN10 homolog antibody
    • S5A antibody
    • S5a/antisecretory factor protein antibody
    see all

Images

  • All lanes : Anti-Proteasome 19S S5A/ASF antibody (ab140689) at 0.1 µg/ml

    Lane 1 : Whole cell lysate prepared from 293T cells at 50 µg
    Lane 2 : Whole cell lysate prepared from 293T cells at 15 µg
    Lane 3 : Whole cell lysate prepared from HeLa cells at 50 µg
    Lane 4 : Whole cell lysate prepared from Jurkat cells at 50 µg

    Developed using the ECL technique.

    Predicted band size: 40 kDa


    Exposure time: 10 seconds
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung carcinoma tissue labelling Proteasome 19S S5A/ASF with ab140689 at 1/5000 (0.2µg/ml). Detection: DAB.

  • ab140689 at 1 µg/ml detecting Human Proteasome 19S S5A/ASF in 293T whole cell lysate by WB following IP.

    Lane 1: IP with an antibody which recognizes a different epitope of Human Proteasome 19S S5A/ASF.
    Lane 2: ab140689 at 6 µg/mg of lysate.
    Lane 3: Control IgG.

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.

    Detection: Chemiluminescence with an exposure time of 3 seconds

References

ab140689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up