Overview

  • Product name

    Anti-Proteasome 20S alpha 2/HC3 antibody
    See all Proteasome 20S alpha 2/HC3 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 20S alpha 2/HC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Proteasome 20S alpha 2/HC3 aa 120-227.
    Sequence:

    EYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVN GKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFR RLTPTEVK


    Database link: P25787

  • Positive control

    • IHC-P: Human brain tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as Proteasome 20S alpha 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.
  • Sequence similarities

    Belongs to the peptidase T1A family.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues; which may be important for nuclear import.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HC3 antibody
    • Macropain subunit C3 antibody
    • MU antibody
    • Multicatalytic endopeptidase complex subunit C3 antibody
    • PMSA2 antibody
    • Proteasome (prosome macropain) subunit alpha type 2 antibody
    • Proteasome alpha 2 subunit antibody
    • Proteasome component C3 antibody
    • Proteasome subunit alpha type 2 antibody
    • Proteasome subunit alpha type-2 antibody
    • Proteasome subunit HC3 antibody
    • PSA2_HUMAN antibody
    • PSC2 antibody
    • PSC3 antibody
    • PSMA 2 antibody
    • psmA2 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for Proteasome 20S alpha 2/HC3 with ab239017 at a 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Proteasome 20S alpha 2/HC3 using ab239017 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab239017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up