Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
Key features and details
- Rabbit polyclonal to Proteasome 20S alpha 5/PSMA5
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome 20S alpha 5/PSMA5 antibody
See all Proteasome 20S alpha 5/PSMA5 primary antibodies -
Description
Rabbit polyclonal to Proteasome 20S alpha 5/PSMA5 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human Proteasome 20S alpha 5/PSMA5 aa 1-241.
Sequence:MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV EKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHW FTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKG PQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLI ILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
Database link: P28066 -
General notes
This product was previously labelled as Proteasome 20S alpha 5
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab189855 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 26 kDa. | |
ICC/IF | Use at an assay dependent concentration. |
Target
-
Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. -
Tissue specificity
Expressed in fetal brain (at protein level). -
Sequence similarities
Belongs to the peptidase T1A family. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 510155 Cow
- Entrez Gene: 5686 Human
- Entrez Gene: 26442 Mouse
- Entrez Gene: 29672 Rat
- Omim: 176844 Human
- SwissProt: Q5E987 Cow
- SwissProt: P28066 Human
- SwissProt: Q9Z2U1 Mouse
see all -
Alternative names
- Macropain zeta chain antibody
- Multicatalytic endopeptidase complex zeta chain antibody
- Proteasome (prosome macropain) subunit alpha type 5 antibody
see all
Images
-
Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab189855. Blue DAPI for nuclear staining.
-
All lanes : Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855) at 1/500 dilution
Lane 1 : MCF7 cell extract
Lane 2 : 293T cell extract
Lane 3 : HepG2 cell extract
Lane 4 : U-251MG cell extract
Lane 5 : BxPC3 cell extract
Lane 6 : Mouse liver extract
Lane 7 : Mouse thymus extract
Lane 8 : Mouse heart extract
Predicted band size: 26 kDa
Protocols
Datasheets and documents
References (1)
ab189855 has been referenced in 1 publication.
- Schmidt H et al. IL-13 Impairs Tight Junctions in Airway Epithelia. Int J Mol Sci 20:N/A (2019). PubMed: 31262043