For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    proteasome-20s-alpha-5psma5-antibody-ab189855.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Proteasome
Share by email

Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
  • Western blot - Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)

Key features and details

  • Rabbit polyclonal to Proteasome 20S alpha 5/PSMA5
  • Suitable for: WB, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Proteasome 20S alpha 5/PSMA5 antibody
    See all Proteasome 20S alpha 5/PSMA5 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 20S alpha 5/PSMA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Proteasome 20S alpha 5/PSMA5 aa 1-241.
    Sequence:

    MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV EKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHW FTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKG PQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLI ILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI


    Database link: P28066
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

     This product was previously labelled as Proteasome 20S alpha 5

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Mouse thymus tissue lysate - total protein (ab29285)
    • Mouse liver tissue lysate - total protein (ab29301)
    • Mouse heart normal tissue lysate - total protein (ab30291)
  • Recombinant Protein

    • Recombinant Human Proteasome 20S alpha 5/PSMA5 protein (ab123211)
  • Related Products

    • Recombinant Human Proteasome 20S alpha 5/PSMA5 protein (ab123211)

Applications

Our Abpromise guarantee covers the use of ab189855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 26 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
  • Tissue specificity

    Expressed in fetal brain (at protein level).
  • Sequence similarities

    Belongs to the peptidase T1A family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Target information above from: UniProt accession P28066 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 510155 Cow
    • Entrez Gene: 5686 Human
    • Entrez Gene: 26442 Mouse
    • Entrez Gene: 29672 Rat
    • Omim: 176844 Human
    • SwissProt: Q5E987 Cow
    • SwissProt: P28066 Human
    • SwissProt: Q9Z2U1 Mouse
    • SwissProt: P34064 Rat
    • Unigene: 485246 Human
    • Unigene: 208883 Mouse
    • Unigene: 1276 Rat
    see all
  • Alternative names

    • Macropain zeta chain antibody
    • Multicatalytic endopeptidase complex zeta chain antibody
    • Proteasome (prosome macropain) subunit alpha type 5 antibody
    • Proteasome alpha5 subunit antibody
    • Proteasome component 5 antibody
    • Proteasome subunit alpha type 5 antibody
    • Proteasome subunit alpha type-5 antibody
    • Proteasome subunit zeta antibody
    • Proteasome zeta chain antibody
    • PSA5_HUMAN antibody
    • PSC5 antibody
    • PSMA5 antibody
    • ZETA antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
    Immunocytochemistry/ Immunofluorescence - Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
    Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab189855. Blue DAPI for nuclear staining.
  • Western blot - Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
    Western blot - Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
    All lanes : Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855) at 1/500 dilution

    Lane 1 : MCF7 cell extract
    Lane 2 : 293T cell extract
    Lane 3 : HepG2 cell extract
    Lane 4 : U-251MG cell extract
    Lane 5 : BxPC3 cell extract
    Lane 6 : Mouse liver extract
    Lane 7 : Mouse thymus extract
    Lane 8 : Mouse heart extract

    Predicted band size: 26 kDa

Protocols

  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab189855? Please let us know so that we can cite the reference in this datasheet.

    ab189855 has been referenced in 1 publication.

    • Schmidt H  et al. IL-13 Impairs Tight Junctions in Airway Epithelia. Int J Mol Sci 20:N/A (2019). PubMed: 31262043

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab189855.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.