Overview

  • Product name

    Anti-Proteasome 20S beta 3 antibody
    See all Proteasome 20S beta 3 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 20S beta 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Rainbow trout
  • Immunogen

    Recombinant full length protein corresponding to Human Proteasome 20S beta 3 aa 1-205.
    Sequence:

    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLY IGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRF GPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMC ESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTL KARMD


    Database link: P49720

  • Positive control

    • WB: HeLa, MCF7, HepG2, K562, Jurkat, NIH/3T3 and HEK-293T whole cell lysate. IHC-P: Human skin and placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 23 kDa (predicted molecular weight: 23 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-Proteasome 20S beta 3 antibody (ab230024) at 1/1000 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 5 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 6 : NIH/3T3 (Mouse embyro fibroblast cell line) whole cell lysate
    Lane 7 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 23 kDa
    Observed band size: 23 kDa

  • Paraffin-embedded human skin tissue stained for Proteasome 20S beta 3 with ab230024 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for Proteasome 20S beta 3 with ab230024 at 1/100 dilution in immunohistochemical analysis.

References

ab230024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up