Overview

  • Product name

    Anti-Proteasome 20S C2/HC2 antibody
    See all Proteasome 20S C2/HC2 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 20S C2/HC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome 20S C2/HC2 aa 213-263.
    Sequence:

    GIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPME H


    Database link: P25786

  • Positive control

    • 293T, HeLa, Jurkat whole cell lysates.
  • General notes

     This product was previously labelled as Proteasome 20S C2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH: 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab140499 was affinity purified using an epitope specific to Proteasome 20S C2/HC2 immobilized on a solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 30 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome (By similarity). Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells.
  • Sequence similarities

    Belongs to the peptidase T1A family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 30 kDa prosomal protein antibody
    • HC 2 antibody
    • HC2 antibody
    • Macropain subunit C2 antibody
    • Macropain subunit nu antibody
    • MGC14542 antibody
    • MGC14575 antibody
    • MGC14751 antibody
    • MGC1667 antibody
    • MGC21459 antibody
    • MGC22853 antibody
    • MGC23915 antibody
    • Multicatalytic endopeptidase complex subunit C2 antibody
    • NU antibody
    • PROS 30 antibody
    • PROS-30 antibody
    • PROS30 antibody
    • Proteasome (prosome macropain) subunit alpha type 1 antibody
    • Proteasome alpha 1 subunit antibody
    • Proteasome component C2 antibody
    • Proteasome nu chain antibody
    • Proteasome subunit alpha type 1 antibody
    • Proteasome subunit alpha type I antibody
    • Proteasome subunit alpha type-1 antibody
    • Proteasome subunit nu antibody
    • Protein P30 33K antibody
    • PSA1_HUMAN antibody
    • PSC 2 antibody
    • PSC2 antibody
    • PSMA 1 antibody
    • psmA1 antibody
    see all

Images

  • All lanes : Anti-Proteasome 20S C2/HC2 antibody (ab140499) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa


    Exposure time: 30 seconds
  • ab140499 at 1 µg/ml detecting Proteasome 20S C2/HC2 in 293T whole cell lysate by WB following IP.

    Lane 1: ab140499 at 6µg/mg of lysate.
    Lane 2: Control IgG.

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded. Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab140499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up