Overview

  • Product name

    Anti-Proteasome 26S S3/PSMD3 antibody
    See all Proteasome 26S S3/PSMD3 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 26S S3/PSMD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Chinese hamster
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome 26S S3/PSMD3 aa 1-50.
    Sequence:

    MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGE


    Database link: NP_002800.2

  • Positive control

    • Recombinant Human Proteasome 26S S3/PSMD3 protein (ab117003) can be used as a positive control in WB. 293T, HeLa, Jurkat and NIH 3T3 whole cell lysates.
  • General notes

     This product was previously labelled as Proteasome 26S S3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab140440 was affinity purified using an epitope specific to Proteasome 26S S3/PSMD3 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/1000. Predicted molecular weight: 61 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-Proteasome 26S S3/PSMD3 antibody (ab140440) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 61 kDa


    Exposure time: 30 seconds
  • Detection of Proteasome 26S S3/PSMD3 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140428 at 6 µg/mg lysate for IP and 0.4µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab140440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (HEK293 cells)
Gel Running Conditions
Reduced Denaturing (12,5%)
Loading amount
20 µg
Specification
HEK293 cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted May 23 2017

Application
Western blot
Sample
Rat Tissue lysate - whole (brain)
Loading amount
30 µg
Specification
brain
Gel Running Conditions
Non-reduced Non-Denaturing (Native) (10%)
Blocking step
Milk as blocking agent for 20 minute(s) · Concentration: 2% · Temperature: RT°C

Abcam user community

Verified customer

Submitted May 02 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up