Anti-Proteasome Activator Subunit 4/PSME4 antibody (ab157158)
Key features and details
- Rabbit polyclonal to Proteasome Activator Subunit 4/PSME4
- Suitable for: IHC-P, WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome Activator Subunit 4/PSME4 antibody
See all Proteasome Activator Subunit 4/PSME4 primary antibodies -
Description
Rabbit polyclonal to Proteasome Activator Subunit 4/PSME4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Synthetic peptide corresponding to Human Proteasome Activator Subunit 4/PSME4 aa 1-50.
Sequence:MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDL
Database link: NP_055429.2 -
Positive control
- 293T, HeLa and Jurkat whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab157158 was affinity purified using an epitope specific to Proteasome Activator Subunit 4/PSME4 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab157158 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/1000.
|
|
WB |
1/1000 - 1/5000. Predicted molecular weight: 211 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
IHC-P
1/1000. |
WB
1/1000 - 1/5000. Predicted molecular weight: 211 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
Activates proteasomal cleavage of peptides in an energy-independent manner. May be involved in spermatogenesis. May be involved in DNA repair. -
Sequence similarities
Contains 6 HEAT repeats. -
Cellular localization
Nucleus. Nucleus speckle. Found in nuclear foci following treatment with ionizing radiation, but not with ultraviolet irradiation or H(2). - Information by UniProt
-
Database links
- Entrez Gene: 459229 Chimpanzee
- Entrez Gene: 23198 Human
- Omim: 607705 Human
- SwissProt: Q14997 Human
- Unigene: 413801 Human
-
Alternative names
- KIAA0077 antibody
- PA200 antibody
- Proteasome Activator 200 kDa antibody
see all
Images
-
All lanes : Anti-Proteasome Activator Subunit 4/PSME4 antibody (ab157158) at 0.4 µg/ml
Lane 1 : 293T whole
cell lysate at 50 µg
Lane 2 : 293T whole
cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole
cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 211 kDa
Exposure time: 3 minutes -
Detection of Proteasome Activator Subunit 4/PSME4 by Western Blot of Immunprecipitate.
ab157158 at 1µg/ml labeling Proteasome Activator Subunit 4/PSME4 in 293T whole cell lysate immunoprecipitated using ab157158 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
Detection: Chemiluminescence with exposure time of 10 seconds. -
Immunohistochemistry if human non-small cell lung cancer staining Proteasome Activator Subunit 4/PSME4 with ab157158 at 1/1000.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab157158 has not yet been referenced specifically in any publications.